CAZyme Information: MGYG000000554_01396

Basic Information

• Species: Campylobacter fetus
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter; Campylobacter fetus
• CAZyme ID: MGYG000000554_01396
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354		39503.81	9.9963

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000554	1538481	MAG	China	Asia

• Gene Location: Start: 900; End: 1964 Strand: +

Full Sequence      

MKKLIIFFASVYLLFGASNDEAELKKMIGQMIMIGFSHSSANDSWTDQLVLDAGFGRIGG
VMLLARNISTKDELIKLTKKLSSSKSKHKLLIAIDEEGGKVSRFINKDGFKHFPSAYEVG
SKMNLNKAGIIYKDMADQLKNLGINMNFAPVVDVYNPNSSIIGQKNRAFSKNPDEVIAYS
SEFIKSFDKANIKTVLKHFPGHGNAIKDTHKEKTVVDNYDFDELKPYFELIKRGQASFIM
VAHVYIPNLDDKNPAVLSKHIVSDILKNRFKFKGAVMSDDLLMKGLGELSIEQKVVRAIN
AGVDIVLVSEYFLNNSNSIKIINDAILNAVNSGKISKERIKDAYTRILRSKEGL

Enzyme Prediction     

No EC number prediction in MGYG000000554_01396.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	83	308	1.3e-50	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.88e-68	24	352	3	313	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.45e-55	28	349	6	315	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	4.06e-53	58	308	26	279	beta-hexosaminidase; Provisional
PRK15098	PRK15098	7.78e-10	143	351	150	353	beta-glucosidase BglX.
PLN03080	PLN03080	0.001	171	343	175	355	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMS61801.1	1.58e-240	1	354	1	354
QYA64876.1	1.58e-240	1	354	1	354
QMS65753.1	1.58e-240	1	354	1	354
QEL44735.1	1.58e-240	1	354	1	354
QYA61401.1	1.58e-240	1	354	1	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.51e-37	24	352	13	338	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
6JTI_A	5.18e-34	58	308	69	324	Crystalstructure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_B Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_C Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_D Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_E Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_F Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTJ_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_C Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_D Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_E Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_F Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTK_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_C Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_D Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_E Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_F Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTL_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with zinc ion [Neisseria gonorrhoeae],6JTL_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with zinc ion [Neisseria gonorrhoeae]
3BMX_A	3.22e-33	20	307	40	347	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.34e-32	20	307	14	321	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.55e-32	20	307	44	351	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48823	1.11e-36	17	307	11	334	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q8EEW2	1.91e-36	57	308	25	279	Beta-hexosaminidase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=nagZ PE=3 SV=1
Q0HJG7	2.67e-36	57	308	25	279	Beta-hexosaminidase OS=Shewanella sp. (strain MR-4) OX=60480 GN=nagZ PE=3 SV=1
Q0HVQ8	3.72e-36	57	308	25	279	Beta-hexosaminidase OS=Shewanella sp. (strain MR-7) OX=60481 GN=nagZ PE=3 SV=1
Q080R9	7.08e-36	57	308	25	279	Beta-hexosaminidase OS=Shewanella frigidimarina (strain NCIMB 400) OX=318167 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.030384	0.785281	0.183338	0.000302	0.000324	0.000336

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000554_01396.