CAZyme Information: MGYG000000555_00289

Basic Information

• Species: Cellulosilyticum sp900556665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Cellulosilyticaceae; Cellulosilyticum; Cellulosilyticum sp900556665
• CAZyme ID: MGYG000000555_00289
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
946		106774.62	5.5564

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000555	2866181	MAG	China	Asia

• Gene Location: Start: 7785; End: 10625 Strand: +

Full Sequence      

MINLMDLQGEWQFVLDPEKKGMPEVFSDVITLPNTTSHAKKGPINEAVKINCLTDEYDFS
GWAWFQKEVDIFDFAAQQRVFLFLERTRVTKLWIDDMLIGMQNSLCTPHIYEVTSTLTPG
KHTLTICVDNTNYPTKGGHLTSEDTQTNWNGITGKIELLFFNKSLLKDIMLFPNAQDCTV
TIKGQFENPAPTTLHIEAESFNSDKLHHVTPMRYTICESSFEITYALGDKALLWDEHHPN
LYKLILKCTHNDILLDQHELTFGLRDFKGTPDYFTINNHPIFLRGKHDGLIFPLTGFAPT
DLDSWLHILGIAKSYGINHYRFHTCCPPEAAFEAADRLGIYMQPELPFWGTITAPGEKNH
NQAEQDYLIEEGFRILRHFGNHPSFVMMSLGNELWGSQAILNKILGDYKAFDCRHLYVQG
SNNFQFSPCILENDDFFSGVRFSHDRLLRGSYAMCDAPQGILQTMPPSTHYSFDEAIRPT
EMIACSSSNKQTIEIQYGTGVKTVSLSEINDALLPQIPVISHEVGQYETFPNFDETPKYT
GSIKAKNLEVFRRRLEEKGLLYLAPLYFKCSGALAVACYKEEIETALRSKHLAGFQLLDL
QDFSGQGTALVGILDAFMDSKGLISAKDWRHFCGDTVLLGDFGTYIYEAGDLFTSKVQLA
NYSDSFSTCALAHPNAQQAPQVIHWQLTSSHEVLNQGTLTVSPNAYGLVDIGEVKCTLPE
VSVPTPIVFTLTMSSTSSLEPITNSYEIIVYPHLEFELNEVIHGEGQSLHITHNFAKANE
LLQQGKRVLLLPDKLTHAIPGTYCTDFWCYPMFRSISESVNKPLPIGTMGLLIQNEHPAL
TDFPSKPYTTPCWYHLITHSDCKILDDTSTYIRPIVQMIDNFERNHNLGILYEANVGQGK
LLVCTSRLTEIWSHIEVRHFAKSIITYALSPNFAPQITLPLDASLI

Enzyme Prediction     

No EC number prediction in MGYG000000555_00289.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	436	1.5e-57	0.48404255319148937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	9.96e-21	6	394	14	407	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.50e-18	3	393	11	417	beta-D-glucuronidase; Provisional
pfam00703	Glyco_hydro_2	4.06e-07	174	265	14	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	6.19e-07	7	130	4	135	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam02836	Glyco_hydro_2_C	6.27e-07	274	393	8	135	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAV13119.1	0.0	1	939	1	924
ADL53165.1	0.0	1	939	1	924
QAA34542.1	0.0	1	936	1	921
AOZ93913.1	0.0	1	936	1	921
AIQ24051.1	0.0	1	936	1	921

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GM8_A	8.05e-13	60	397	65	400	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
4JKK_A	3.36e-12	3	393	14	411	CrystalStructure of Streptococcus agalactiae beta-glucuronidase in space group I222 [Streptococcus agalactiae 2603V/R],4JKL_A Crystal Structure of Streptococcus agalactiae beta-glucuronidase in space group P21212 [Streptococcus agalactiae 2603V/R],4JKL_B Crystal Structure of Streptococcus agalactiae beta-glucuronidase in space group P21212 [Streptococcus agalactiae 2603V/R]
6S6Z_A	1.65e-10	64	393	123	440	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	1.65e-10	64	393	124	441	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q03WL0	1.49e-11	92	393	148	456	Beta-galactosidase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y) OX=203120 GN=lacZ PE=3 SV=1
O07684	1.31e-10	88	401	157	476	Beta-galactosidase large subunit OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=lacL PE=3 SV=2
T2KPJ7	2.71e-10	53	395	96	432	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q56307	9.01e-10	64	393	124	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	9.05e-08	92	398	165	486	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000555_00289.