CAZyme Information: MGYG000000555_00321

Basic Information

• Species: Cellulosilyticum sp900556665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Cellulosilyticaceae; Cellulosilyticum; Cellulosilyticum sp900556665
• CAZyme ID: MGYG000000555_00321
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		45534.88	7.9203

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000555	2866181	MAG	China	Asia

• Gene Location: Start: 6974; End: 8158 Strand: -

Full Sequence      

MIILVWILELCILYDIIISAFAFKRKEIPSEYALNPCATFTVLIACHNEEEVIVDNLQAL
YNSHYDKRLFNVYVIADNCTDQTEMLCHEFKANHRDFNMEVIPVKGGSKPKALNCGIEYL
KKHNLWKDEYIVILDADNKVSPQMLSAFDYYHGQFDILQCRIRSDNDESFIARSFTAAFN
RTTYDRQISRNNAGLSASLSGTGFSIHRNVFDDVDFQHCTTLTEDLEFSVLAILKGYKIK
FVNEQYVLNQNLDELKPSMIQRIRWCRGHTQVSVKLTGPVIREFIRKPRLQLIETFLFIN
TPARVIIFTVVGIYILITRMYIPPFLVILSTIICIYAILYGIYCNNYDLSYVPNLFHYAI
CMYGAVLYGALTYKKTAWAKTAHKKITSNTTNIK

Enzyme Prediction     

No EC number prediction in MGYG000000555_00321.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	39	268	5.6e-27	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	8.54e-34	42	228	1	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	7.48e-33	1	383	18	418	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.26e-30	42	225	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	2.02e-17	39	268	3	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd04192	GT_2_like_e	7.66e-17	42	265	1	226	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH67816.1	1.47e-202	1	387	1	387
AST93419.1	2.32e-39	13	320	26	330
QSW19839.1	2.90e-37	13	302	21	304
AUS95574.1	1.12e-36	13	307	30	320
AWC38853.1	3.55e-35	13	304	36	330

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.17e-14	41	293	52	300	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q5HCN1	6.87e-12	13	275	16	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q9RQP9	6.87e-12	13	275	16	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q99QX3	6.87e-12	13	275	16	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1
Q7A351	6.87e-12	13	275	16	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.878572	0.120342	0.000458	0.000221	0.000144	0.000270

TMHMM  Annotations     

start	end
4	23
296	318
322	344
351	373