CAZyme Information: MGYG000000555_00352

Basic Information

• Species: Cellulosilyticum sp900556665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Cellulosilyticaceae; Cellulosilyticum; Cellulosilyticum sp900556665
• CAZyme ID: MGYG000000555_00352
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		43762.98	5.1298

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000555	2866181	MAG	China	Asia

• Gene Location: Start: 18066; End: 19187 Strand: +

Full Sequence      

MDMLRNYIEELIDKSTPERPIWNIEKILEGKPPTWNYIDGCMIKALLEMYAITKGEKYLK
FADEFITYHVREDGSINNYDIHELNIDNVNSGKVLFELYDITGKERYRKAIDTVYEQIKI
QPRTKEGNFWHKKIYPNQVWLDGLYMGQPFYMEYETRFNNKAHYEDIFNQFCNVEKFMKD
AKTGLYYHGYDSSREAKWCNKETGLSRNFWLRALGWFVMALIDTIDKMDKSYTEMYTKLM
EMFKDLTTSLLKFQDESGMWYQVVDQGGREGNYLETSGSAIMAYAILKGVRMGFLPESYA
QYGEKAFKGICDKYLYEKDGEMNLGGICLVAGLGRPDSRDGSYEYYISEPVVENEAKGVA
PLLLVYTEILRRK

Enzyme Prediction     

No EC number prediction in MGYG000000555_00352.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	31	371	4e-121	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	4.12e-100	35	371	34	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.83e-93	12	373	2	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH68585.1	2.88e-250	1	371	1	371
ADZ83101.1	8.24e-250	1	371	1	371
CBL09353.1	5.83e-200	1	371	1	372
VCV21981.1	4.77e-199	1	371	1	372
ABX40590.1	6.77e-199	1	371	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	7.61e-119	35	368	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	6.37e-70	28	369	30	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.68e-69	28	369	20	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	3.28e-16	35	310	65	328	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	6.84e-14	99	372	123	380	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.49e-69	28	369	30	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.03e-43	146	370	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.03e-43	146	370	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	3.18e-24	35	323	29	297	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000555_00352.