CAZyme Information: MGYG000000555_00422

Basic Information

• Species: Cellulosilyticum sp900556665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Cellulosilyticaceae; Cellulosilyticum; Cellulosilyticum sp900556665
• CAZyme ID: MGYG000000555_00422
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460		52114.7	5.727

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000555	2866181	MAG	China	Asia

• Gene Location: Start: 12393; End: 13775 Strand: -

Full Sequence      

MKFMGDYVKDIKITYIGGGSRGWAWRLMSDLAMEEQLLGTVKLYDIDYEAALNNEKIGND
LAKRDDVKSKWIYKAEKNLDEALKGADFVIISILPGTFNEMASDVHAPEQYGIYQSVGDT
VGPGGLIRGLRTVPMYAQFAKAIEKNCPNAWVINYTNPMSICMKALYTVFPKIKAFGCCH
EVFHTQTLLTHALKELEGIEDVKREEIKVNVLGINHFTWLDHASYKNIDLMPIYKKFVDK
YYIDGYETGKTGNWMNDSFTSANRVKFDLFKRYGLIAAAGDRHLAEFMQGNWYVENPETV
MQWKFGLTTVSWRRQDLEERLEKSRRLVNGEEAFELKASGEDGVKQIKALLGLEDLVTNV
NMPNQGQISNIGLGNIVETNALFRKDQVIPLMAGELPNAIQSIVTRHISNQNAIVEAALT
KDKNKAFMAFANDPLVTLSLEDSRELFSQMIKNTEAYLDF

Enzyme Prediction     

No EC number prediction in MGYG000000555_00422.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	12	191	5.8e-58	0.9832402234636871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	7.99e-156	11	451	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	1.88e-103	9	458	2	436	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	9.02e-68	12	458	3	427	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	1.10e-59	12	195	1	183	Family 4 glycosyl hydrolase.
cd05197	GH4_glycoside_hydrolases	5.48e-52	11	451	1	423	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACZ98662.1	4.40e-317	1	459	1	459
QEH68028.1	1.43e-265	1	458	1	458
ADZ82340.1	2.88e-265	1	458	1	458
SNX53414.1	1.83e-233	1	459	1	459
AFK85236.1	2.17e-230	1	459	1	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	4.02e-163	11	452	6	437	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
1S6Y_A	1.58e-27	9	456	6	446	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
5C3M_A	9.65e-27	9	458	3	434	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1OBB_A	1.28e-19	11	422	4	437	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
1U8X_X	7.30e-18	9	266	27	277	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I3VRU1	4.34e-231	1	459	1	459	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	4.67e-211	1	458	1	450	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
A9KTB9	1.30e-182	1	458	1	460	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
P39130	1.91e-167	11	452	10	441	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
O34645	1.50e-44	12	442	3	412	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000555_00422.