CAZyme Information: MGYG000000555_01034

Basic Information

• Species: Cellulosilyticum sp900556665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Cellulosilyticaceae; Cellulosilyticum; Cellulosilyticum sp900556665
• CAZyme ID: MGYG000000555_01034
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435		49595.17	9.3251

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000555	2866181	MAG	China	Asia

• Gene Location: Start: 4491; End: 5798 Strand: -

Full Sequence      

MKRSRYVSVKTKFFIALTTALAWVALSIFLSRSWLQSLSSVTNFFISFLIIAGIAYIPGF
MNTFLLTSVLIDKQPEFKNDDPDDDITILVAAYNEGDTIYDTLSYINAQDYKGKIKTIVI
NNNSNDHTVQEVLRANRELPLDIECIDENTPGKFNALNAGLKKATTEFIITLDADTILHK
SAVRYLVARIKSAPNDIAAVAGSVLVRNSRDNLLAKLQEWDYFLCIMSIKRMQGLFQGTL
VAQGAFSIYKTSVVKEIGGWSDAIGEDIILTWNMLAKNLKVYYEPLAIAFTDVPTEFSHF
VKQRSRWARGMIEGLRLIKPWEQPNMYYKFLTGIDICILFMDIAYVLFFIPGVILALFGK
FYIVGPFSLLVVPLTVLTFALLFFKQRTFFKALDLKVRKNSLGFTVFILCYQFIISPISL
YGYIQEFFNMKRVWK

Enzyme Prediction     

No EC number prediction in MGYG000000555_01034.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	83	310	1e-31	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	6.52e-51	88	267	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	2.49e-46	42	424	12	406	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	1.44e-42	38	384	3	351	N-glycosyltransferase; Provisional
PRK14583	hmsR	1.12e-31	86	432	77	427	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
cd06439	CESA_like_1	1.57e-27	73	314	18	251	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOK29384.1	4.32e-189	2	434	16	449
AKP46057.1	5.32e-189	6	435	16	446
AND40888.1	7.08e-188	2	434	16	449
AIE60039.1	1.04e-187	2	435	17	451
QYY41431.1	7.63e-187	6	435	18	448

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SP7_A	5.89e-15	145	310	170	346	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
7SP6_A	2.46e-14	145	310	170	346	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
6YV7_B	2.23e-09	86	325	44	301	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	2.24e-09	86	325	45	302	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
5TZE_C	3.99e-07	87	200	4	118	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8NUI7	3.09e-40	43	310	5	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaA PE=3 SV=1
Q6G608	3.09e-40	43	310	5	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaA PE=3 SV=1
Q7A351	1.15e-39	43	310	5	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q9RQP9	1.15e-39	43	310	5	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q6GDD8	1.15e-39	43	310	5	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35
45	67
336	358
362	384
403	425