CAZyme Information: MGYG000000555_01454

Basic Information

• Species: Cellulosilyticum sp900556665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Cellulosilyticaceae; Cellulosilyticum; Cellulosilyticum sp900556665
• CAZyme ID: MGYG000000555_01454
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330		38448.46	4.6092

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000555	2866181	MAG	China	Asia

• Gene Location: Start: 1328; End: 2320 Strand: +

Full Sequence      

MEERIVYYVDNDPEKNHAQTKLNGKVIEIISPQEMLQEISAEDIILIGSFRFKEIIDQLD
TMSELNDIQVYVVKLFMEDLSETTYKGGIVYSPTRQIPKKIHYCWFGGKEMGELEKHCLA
TWKKFCPDYEIIRWDETNYDYTQNQYISDAYKSGKYAFVSDYARLDVIYRYGGIYLDTDV
EILRSIDQLLYQRGFMGFESNSMVNSGVGMGGVAGIELFATLRDAYQNYVFIDSNGKIND
VANCNLQSAILKEKGLRLDNTLQEIDGIRFYPSEFLSPVSYLTNKKHITENTYSVHWFTG
SWQTEVGTTYRNQQLQYMDEIIERLKRESM

Enzyme Prediction     

No EC number prediction in MGYG000000555_01454.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	114	190	7.2e-24	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04488	Gly_transf_sug	6.95e-16	112	192	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
COG3774	OCH1	2.56e-15	97	231	82	216	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam05704	Caps_synth	2.48e-14	96	229	45	191	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.007	143	192	157	204	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ92956.1	5.57e-77	1	306	41	351
BCJ92955.1	1.05e-71	4	321	43	364
BCJ92952.1	2.40e-69	5	302	45	342
BBF44126.1	1.07e-68	4	302	44	348
QBS00042.1	6.79e-68	97	302	2	207

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	3.88e-07	82	208	42	171	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000555_01454.