CAZyme Information: MGYG000000556_00798

Basic Information

• Species: Collinsella sp003469205
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp003469205
• CAZyme ID: MGYG000000556_00798
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
207		23968.25	8.6628

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000556	1959616	MAG	China	Asia

• Gene Location: Start: 10003; End: 10626 Strand: -

Full Sequence      

MHGWQFHTLTEDIQFTTFCAIHGIRIGYAPAEFFDEQPVTFKASWKQRMRWTKGFYQVFF
TYGKHLVKSTFRYHRFAAYDMFMTIAPGMLLSLISMLANATFLIVGGLSHGFLATEVEMQ
ACAASLIMTFAMMYQTFFILALLTTIFEYKHIHCAQKWRLVTNLFTFPIFMFSYIPITVA
ALFLKVDWVPTQHAVNVTLDEVMQGAK

Enzyme Prediction     

No EC number prediction in MGYG000000556_00798.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	7.64e-11	3	180	231	401	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	1.12e-06	3	143	226	362	N-glycosyltransferase; Provisional
cd06427	CESA_like_2	5.34e-05	3	65	178	240	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
pfam13632	Glyco_trans_2_3	7.33e-05	1	106	87	189	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
PRK14583	hmsR	4.77e-04	4	97	248	344	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33195.1	8.52e-145	1	207	225	431
ATP53496.1	3.45e-144	1	207	225	431
AZH69681.1	1.40e-143	1	207	225	431
AEB07123.1	2.94e-104	1	207	225	431
AKT50107.1	4.90e-96	1	207	222	428

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
83	105
125	147
160	182