CAZyme Information: MGYG000000557_00032

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000000557_00032
• CAZy Family: GH103
• CAZyme Description: Membrane-bound lytic murein transglycosylase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	MGYG000000557_1|CGC1	40371.04	6.1796

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000557	2365525	MAG	China	Asia

• Gene Location: Start: 34650; End: 35741 Strand: -

Full Sequence      

MPKISRRQLGAYAAVLGLGLISDGLRQPLLAAPPPAGLTYPEREEVTAFLKEVSTQKGIP
YEWLETEIALARYSPLAERYMTPKPKTGPATTPERNFRLYHRNMVNMERIQKGLDFLARH
TELFAHIEETQGVSRHAIAAIIGIETIYGKNMGRFRVLDVLVTLAFDYTRRATFYRKELA
EFLDFCWRDKLPTVSVTGSYAGAVGFGQFMPSSLNRFGTDGDGDGFIDIISNEADGIASV
ATYLREHGWKSGLKPLYPVKQKLNGTEITPSSGIRADHTVGELLSAGIEPIGLLDLAQDH
PVLLVELPWQEAGGELEKRLYLGTQNFSAFLYYNRSYFYAAAVSMLAEALAEAEKRDADQ
PTQ

Enzyme Prediction     

No EC number prediction in MGYG000000557_00032.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	47	350	4e-76	0.9796610169491525

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13406	SLT_2	2.78e-84	50	348	9	292	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
TIGR02282	MltB	2.14e-80	48	350	2	290	lytic murein transglycosylase B. This family consists of lytic murein transglycosylases (murein hydrolases) in the family of MltB, which is a membrane-bound lipoprotein in Escherichia coli. The N-terminal lipoprotein modification motif is conserved in about half the members of this family. The term Slt35 describes a naturally occurring soluble fragment of MltB. Members of this family never contain the putative peptidoglycan binding domain described by pfam01471, which is associated with several classes of bacterial cell wall lytic enzymes. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG2951	MltB	2.25e-69	1	351	1	336	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
PRK10760	PRK10760	1.74e-54	22	356	37	359	murein hydrolase B; Provisional
TIGR02283	MltB_2	1.95e-50	100	351	54	299	lytic murein transglycosylase. Members of this family are closely related to the MltB family lytic murein transglycosylases described by TIGR02282 and are likewise all proteobacterial, although that family and this one form clearly distinct clades. Several species have one member of each family. Many members of this family (unlike the MltB family) contain an additional C-terminal domain, a putative peptidoglycan binding domain (pfam01471), not included in region described by this model. Many sequences appear to contain N-terminal lipoprotein attachment sites, as does E. coli MltB in TIGR02282. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF23912.1	4.45e-126	35	356	46	364
QQS90106.1	5.11e-125	35	358	140	460
QDA55336.1	2.38e-123	35	350	89	404
ANU65602.1	2.91e-65	13	351	9	349
QQQ96748.1	2.91e-65	13	351	9	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O8X_A	2.34e-46	100	353	56	302	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	3.60e-46	100	353	73	319	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
1LTM_A	2.75e-36	49	351	22	315	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]
1D0K_A	2.87e-36	49	351	24	317	ChainA, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0L_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0M_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1QDR_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QDT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUS_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli]
5ANZ_A	1.52e-23	109	348	108	341	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	3.50e-35	49	351	63	356	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000015	0.000056	0.000006	0.990039	0.009862	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000557_00032.