CAZyme Information: MGYG000000557_00592

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000000557_00592
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408	MGYG000000557_3|CGC1	44927.15	5.3695

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000557	2365525	MAG	China	Asia

• Gene Location: Start: 131631; End: 132857 Strand: +

Full Sequence      

MTKLRLTLLCTALLATFGLAEAAETTAAASAAAPTSAQQAKDASAPTEQTVVALPAVRSL
VGAPTDTWPAWKQFRQSALEGGRVIDRSDERLITTSEGQSYGMFFALVANDRASFDAIWQ
WTIANLCAGDCGKTRMAWLWGASESVKAAKTPPKWGVLDSNNATDADLWIAYSLLEAADR
WENPRYREDALALLGRVKQDVRVVRGLGAVLLPANVGFEKNGDVVLNPSYYPLSVLKRLE
AVDPLWREVRWGSMRALVRSAESGLSPDWVAFGERWGTRNRDEGSEGSWNAIRVYLWAGM
MPQDDPDAIRLREILSPMVDITKRRFMTPVSTDTAAFTVSEQGPFAFGACLLPWVKNERV
GAWIRTGLTTMPLTGEDYYRSVLALFGMGFDEARFAFSREGRLVLKGD

Enzyme Prediction     

No EC number prediction in MGYG000000557_00592.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	68	390	9.3e-74	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	3.15e-120	51	406	8	367	cellulase.
COG3405	BcsZ	7.46e-74	66	398	24	351	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	1.12e-53	65	391	1	319	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA53782.1	1.55e-110	68	404	71	408
QQS88762.1	1.68e-106	56	405	16	361
QDA53874.1	2.62e-105	54	406	10	361
ANU67169.1	1.79e-94	61	408	15	353
QQQ96024.1	1.79e-94	61	408	15	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QXQ_A	3.85e-86	67	404	3	336	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
4Q2B_A	1.80e-85	65	404	1	340	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]
7F81_A	3.82e-82	67	403	7	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
7F82_A	1.08e-81	67	403	7	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]
3QXF_A	4.83e-81	67	404	3	336	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X5L9	7.01e-87	67	404	24	357	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	1.11e-85	67	404	24	357	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
Q8ZLB7	1.14e-82	67	404	25	358	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8Z289	1.81e-81	67	404	25	358	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
P58935	4.84e-69	54	404	19	372	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000289	0.998723	0.000443	0.000197	0.000169	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000557_00592.