CAZyme Information: MGYG000000557_00696

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000000557_00696
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386		42220.3	7.4622

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000557	2365525	MAG	China	Asia

• Gene Location: Start: 248259; End: 249419 Strand: -

Full Sequence      

MASGIDREGVFWLAGEASGDFIASLVMPQVRDALGGALCYGIGGPKMAAEGFRAWHDISE
LSVRGYVEVLQHLPRLWRLRRSLAQRISDSLPRAFIGVDAPDFNLGLETELRRRRIPVIH
MVSPSIWAWRPERIQTIRRAVDHMLLLFPFEAKIYRRAGIAATFVGHPLAGIIPMQPQTE
AARAELGVQPEGRPVLCVMPGSRKSELAGCGAIFFEAVSRLIKRAGAMEVLIPVVSDEAK
VAVQQQLAAHPTVLEHAHIVVGASHRMIEASDAVLVASGTAALECALYKKPMVVGYRMPG
LTGLLMEKKGLIDCVSLPNILLGEKVVPEFLQFFCEPDQISWALEDALQNDAKRAQLIER
FSELHTSLMADTAGLTAEVVARLAKS

Enzyme Prediction     

No EC number prediction in MGYG000000557_00696.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	10	368	3.7e-117	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.46e-154	14	386	8	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.07e-132	10	385	4	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.82e-102	10	365	1	359	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.23e-85	5	368	3	369	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	1.82e-44	11	356	230	578	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQS88891.1	1.60e-169	5	380	9	384
QDA54177.1	3.87e-168	5	384	10	389
BBF22932.1	5.69e-168	6	384	11	388
ANU65980.1	4.36e-118	5	383	4	380
QQQ97139.1	4.36e-118	5	383	4	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.66e-76	13	385	12	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	4.67e-76	13	385	12	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1LNE5	2.83e-108	2	386	15	397	Lipid-A-disaccharide synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) OX=266264 GN=lpxB PE=3 SV=1
Q63T25	5.51e-105	1	386	1	384	Lipid-A-disaccharide synthase OS=Burkholderia pseudomallei (strain K96243) OX=272560 GN=lpxB PE=3 SV=1
Q470F0	6.06e-105	7	386	21	398	Lipid-A-disaccharide synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) OX=264198 GN=lpxB PE=3 SV=1
Q3JR42	1.56e-104	1	386	1	384	Lipid-A-disaccharide synthase OS=Burkholderia pseudomallei (strain 1710b) OX=320372 GN=lpxB PE=3 SV=1
A3NAT4	4.43e-104	1	386	1	384	Lipid-A-disaccharide synthase OS=Burkholderia pseudomallei (strain 668) OX=320373 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000557_00696.