CAZyme Information: MGYG000000557_00922

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000000557_00922
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
715		80211.41	9.3642

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000557	2365525	MAG	China	Asia

• Gene Location: Start: 863; End: 3010 Strand: +

Full Sequence      

MHNTKFLSTAVASVLALISTKVLCSVQTLDVQPSVTATTSVVGPPPIATLNNGATAPTGV
VLETRTQGDNDDILERALLPPVRSAEDDRFLDAWKLAQKGQWDKLNAQISTLEGYPLLDY
LKLASMNGALKRTPSDNALQQDYERFIAAHKGDYLAERATSDLLMIAARAMTQGQFNRLY
KTLAWNKEEPPILAAWFIFNASRQNLSQRFAFYRDTNYRGEFLEPLGNSIGASTKNWPWT
KLLIALQKQRWQDATATLKNVDKKTLPTSAKDLTTMLKNPAGWVKKNEAKLSNNPRLALL
YALRIAPANSEGAAEVISVVSDKLPRDERNMVWATIGYHGATDLSANASAWFSHVTGNID
DNALLVQSDIKLSWAIRAALWSQKWEEVERLTRKLPESMQSDETWIYWRARALSALNQPE
RAQPLYRSIASSTSFYGKLAADMLNVAYFLPQAGTVVLPAVTEQRWQQTPSIARAETFYR
LELYFMGHREWNWAMRDLSSPELNQLAEYAKSRALLHRMINTAQRVNPSEQRLEHLFPMP
HRQQFEPIAEQQGTPLAWVYGVIRQESRFMPSVTSSAGAQGLMQIMPKTARWLTRKLSLP
ALSSTADLHDLNTNVMLGSAFLNMLRSDLADSYVLATAAYNAGPGRARKWRSMLANPIEG
AIFIECIPFNETRDYVKNVMANTHTFFLLDGHSKTNFTQLISSIEPNADLNTDLP

Enzyme Prediction     

No EC number prediction in MGYG000000557_00922.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	557	685	1.1e-27	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	4.21e-66	536	686	1	149	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK11619	PRK11619	5.02e-43	241	681	168	619	lytic murein transglycosylase; Provisional
cd16896	LT_Slt70-like	4.87e-40	538	682	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.35e-36	405	682	3	279	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	8.87e-35	557	682	2	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF22242.1	1.22e-152	72	715	146	794
QQS89613.1	1.38e-139	72	715	147	803
QDA54820.1	2.74e-131	72	715	135	790
AON56642.1	3.50e-89	84	715	49	666
AAT42395.1	5.37e-89	84	715	52	670

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	5.75e-56	298	691	172	560	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	6.90e-56	298	691	182	570	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	7.42e-56	298	691	186	574	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	8.25e-56	298	691	192	580	Lytictransglycosylase in action [Neisseria meningitidis]
5O1J_A	8.52e-56	298	691	176	564	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	2.17e-37	360	681	303	620	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	2.17e-37	360	681	303	620	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	2.44e-35	360	681	303	620	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	3.45e-25	360	707	257	590	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31976	6.93e-10	557	682	1438	1540	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000276	0.999097	0.000200	0.000141	0.000131	0.000125

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000557_00922.