CAZyme Information: MGYG000000558_01416

Basic Information

• Species: Caecibacter hominis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Caecibacter; Caecibacter hominis
• CAZyme ID: MGYG000000558_01416
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000000558_22|CGC1	42055.15	5.9643

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000558	2334569	MAG	China	Asia

• Gene Location: Start: 3534; End: 4676 Strand: +

Full Sequence      

MKIMFSAGEASGDMHGANLARALKALDPDIELLGMGGSQMAQAGVRIVYDINNLGFIGVG
EILRKIPFFFRLRTQLLQVMQEEKPDVLVCIDYPGFNMRLIEKARAAGIRVVYYILPTIW
AWHKSRGKVIAEHTDLAISLFPFEAKLYEELGARVAYAGHPLLDVVHPELTKDEALQAFG
LDAAKQTILLMPGSRLQEVRGLLPVMLAAVKEIMAQRDGVQFLIPRASTIDESVLQELIP
ADLENVHVASGHVYDMMNISTAAVAASGTATLETALMGLPTLLIYRVSSLTYWLSKILVH
IQSIGLPNIIMGHRIMPELWQDEVTPEAIAADMVTLLTDKQVWQERHEAMLSVRKEMGEP
GAVRRTAEIILQFAKENHSA

Enzyme Prediction     

No EC number prediction in MGYG000000558_01416.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	357	1.6e-119	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	9.27e-135	1	377	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.48e-123	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.55e-100	3	373	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.69e-88	3	373	8	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	7.14e-56	1	329	2	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB81636.1	2.47e-218	1	380	1	380
AVO26605.1	5.79e-190	1	376	1	376
CCC72315.1	5.79e-190	1	376	1	376
AVO73783.1	5.79e-190	1	376	1	376
ALG41186.1	8.22e-190	1	376	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	3.41e-55	1	375	7	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	9.42e-55	1	375	7	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	2.47e-95	2	373	8	379	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	4.94e-95	2	373	8	379	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	2.45e-92	2	377	8	383	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q2LVL8	8.82e-90	3	377	6	381	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	2.52e-86	2	373	6	377	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999749	0.000283	0.000009	0.000001	0.000000	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000558_01416.