CAZyme Information: MGYG000000559_00085

Basic Information

• Species: Paraprevotella sp900546665
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900546665
• CAZyme ID: MGYG000000559_00085
• CAZy Family: GH98
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
873	MGYG000000559_1|CGC4	99303.02	4.9768

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000559	3371833	MAG	China	Asia

• Gene Location: Start: 111510; End: 114131 Strand: -

Full Sequence      

MKKTVLHHFFAILSLVLLIQPVFAQQRRPISSESPLWLIHIDVWNQADPQKIIDLIPEEI
KPYVCLNLSLSCSYDTDRDVYKMPQNAIRTYKSWASVCQANKMWFTCQPASGGHTHLMDD
DLEIFEYFYKRYPNFLGWNYAEQFWGFNEPGDESSSTIEERLELFAKLVPMAHKYGGFLT
ISFCGNIWSHDLNSIGMMKQNKELYEACQKYPDAILWLYKYTTASCFYNNESVTFSPFVS
GLSNYYGVRYDNCGWNGALSDLFGENNGKTYPVSAGIGTVMEQTCVNGGAVWDGPELIWT
EDFQNLSNTVVDGYTRRNWGTFPGFRNAWLDMFRKIIDGTMYIPSRKEVVENTKIIIIND
ITTGSSEERNASWAELYDGLYKQTDPFNNNNGYWMDNHCYFKKTGRYRTIPVTIGLNDEL
AKSIPVQIKKSAYKREWPILNKKIGEFNAQYPEISKGDLFVSRFKNQLVTYTPYTYLNSK
TTASAIVPLEYNTCDSINLTWGKLSSGIVREYADHIDFYLNNYRTDTTDMVLDKIVVYGA
TTEPTFQLTDRVEAVSKTSAEWDAETKQYTLNVWHMGPVDVTVNCSGTATERRTDLAASS
PLQLPKQPDDYYGEIIIEAEDMDYKNIKKCVVDPYYSYPDVFGHAGNGFMDMGNDKNGTL
RHNLNIENATDYNVTVRYTSPENAGFIAIAVNSTRRMVKCEKTEKNEWKKLSLKFTMKEG
ENKTTIYNPNGLDIYIDNVTYTPTDIPEEKFLITIREAENGKAIASADSAAEGELVTVNP
VPNAGYEFAGWNIIHGNINMSDDNTFTMPDDIVTLQPIFAVSTAINTPTVSDVLPGTQCK
EIYDINGIKRNDLGKGLNIIKTANGSIRKIYIK

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH98	25	341	2.9e-86	0.9877675840978594

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08306	Glyco_hydro_98M	1.44e-93	24	340	5	327	Glycosyl hydrolase family 98. This domain is the putative catalytic domain of glycosyl hydrolase family 98 proteins.
pfam18998	Flg_new_2	5.20e-08	753	820	3	71	Divergent InlB B-repeat domain. This family of domains are found in bacterial cell surface proteins. They are often found in tandem array. This domain is closely related to pfam09479.
pfam08307	Glyco_hydro_98C	1.57e-06	346	530	1	174	Glycosyl hydrolase family 98 C-terminal domain. This putative domain is found at the C-terminus of glycosyl hydrolase family 98 proteins. This domain is not expected to form part of the catalytic activity.
cd04083	CBM35_Lmo2446-like	3.76e-05	643	741	22	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04086	CBM35_mannanase-like	0.001	615	740	1	117	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29515.1	0.0	6	825	2	822
AOZ99817.1	1.87e-170	1	745	1	745
QUT78600.1	4.83e-170	19	739	220	934
QUT26887.1	4.83e-170	19	739	220	934
QRQ55178.1	1.35e-169	19	739	220	934

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WMF_A	6.51e-15	25	530	28	491	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in its native form. [Streptococcus pneumoniae TIGR4]
2WMH_A	6.51e-15	25	530	28	491	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 in complex with the H- disaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]
2WMG_A	3.44e-14	25	530	28	491	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in complex with the LewisY pentasaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000641	0.998466	0.000213	0.000252	0.000224	0.000200

TMHMM  Annotations     

start	end
5	24