CAZyme Information: MGYG000000559_00277

Basic Information

• Species: Paraprevotella sp900546665
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900546665
• CAZyme ID: MGYG000000559_00277
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
772	MGYG000000559_2|CGC2	87540.4	5.5326

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000559	3371833	MAG	China	Asia

• Gene Location: Start: 145712; End: 148030 Strand: +

Full Sequence      

MQHKKRFLLLLSFSCLMWPYGYSASDDIRSQTQWASVEAIGEDVRVPVVGGHASSFQPGA
DITQSFDGDYSTDYHSSWNNAAADYFPITLEYRFERDSEMDYFIYYPRKFGRNGLFGLVE
ISYATYDDDDGPDTKWHRLMDYDFKGYSVAVKVNFPGRLTNVMAIRFTMRSGIGDGQGFV
SCAEMEFYRRESTPFDYGTLFTDPSCSALKPGIGKSDIRACRNPFYRELANRLSDGSYDR
RFRVRPYRAYPHPDVLAASNKTNPYSLMDNPTGISVSKGETLVVLVSDYRDEIVSLRVQN
LDAPDSDGALNAENYPLSPGVNKLCMKDKGLVYVMYHSDKPASAPPVTLHFVTGTVNGYY
DSQDPAHRGRAQELLDHATDDYFDVLGRYAHLTFPVQRFKQHTRDLDSLIAIYDRIVYNE
LELLGLVKYGRMPENRMYLNVMYHSYMYAMPYRMGFHDRTLADLCNEDILTTSACWGPAH
EMGHGNQTSPGMKWLGTTEVTNNIMSEYIQTTVLGQPSRLQVENMNDEVSPNRYSKSWNS
ILVEQKPHAAEEDVFCKLVPFWQLELYFGKVKGLTPHLQDDKGGFYPDVFEYYRTHPDAE
NAGRQQLEFVYVASLASGMDLTDFFRKWGFLTPVDVELTDYVRGRLTVTKADVDAVVKRV
KSLGYPKPAVPLEYITDNTVGLFRSGAPIRKGTALRTGDRLVIRNWENVVAYEVRKNTAD
GPLVCVSDGVLFPSPTVSFSVKGGWDDSYRVYAVAVDNSRVEVELADQDAAR

Enzyme Prediction     

No EC number prediction in MGYG000000559_00277.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13402	Peptidase_M60	2.25e-56	372	629	19	268	Peptidase M60, enhancin and enhancin-like. This family of peptidases contains a zinc metallopeptidase motif (HEXXHX(8,28)E) and possesses mucinase activity. It includes the viral enhancins as well as enhancin-like peptidases from bacterial species. Enhancins are a class of metalloproteases found in some baculoviruses that enhance viral infection by degrading the peritrophic membrane (PM) of the insect midgut. Bacterial enhancins are found to be cytotoxic when compared to viral enhancin, however, suggesting that the bacterial enhancins do not enhance infection in the same way as viral enhancin. Bacterial enhancins may have evolved a distinct biochemical function. These bacterial domains are peptidases targetting host glycoproteins and thus probably play an important role in successful colonisation of both vertebrate mucosal surfaces and the invertebrate digestive tract by both mutualistic and pathogenic microbes. This family has been augmented by a merge with the sequences in the Enhancin Pfam family.
pfam17291	M60-like_N	5.73e-10	235	350	1	107	N-terminal domain of M60-like peptidases. This accessory domain has a jelly roll topology.
NF037974	SslE_AcfD_Zn_LP	1.87e-06	480	676	1183	1389	SslE/AcfD family lipoprotein zinc metalloprotease. Members of this family are surface lipoprotein zinc metalloproteases, from the family that includes accessory colonization factor AcfD from Vibrio cholerae, SslE (YghJ ) from E. coli (Secreted and Surface-associated Lipoprotein from E. coli), and VPA1376 from Vibrio parahaemolyticus. Each is about 1500 amino acids long, and SslE is a known substrate of a type II secretion system (T2SS). SslE is known to have mucinase activity.
pfam18630	Peptidase_M60_C	0.006	693	762	3	65	Peptidase M60 C-terminal domain. This is C-terminal domain (CTD) of M60-peptidases pfam13402. It Can also be found at the C-terminal region of gingipain B (RgpB) from P. gingivalis. It was found to possess a typical Ig-like fold encompassing seven antiparallel beta-strands organized in two beta-sheets, packed into a beta-sandwich structure that can spontaneously dimerize through C-terminal strand swapping. Translocation of gingipains from the periplasm across the OM is dependent on the conserved CTD, which appears to be important for secretion of the proteins and in particular, truncation of the last few C-terminal residues of this domain leads to accumulation of gingipains in the periplasm. Subsequently, the T9SS targeting signal was demonstrated to reside within the last 22 residues at the C-terminus of the CTD. During gingipain translocation across the OM, the CTD is cleaved off by PorU.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM71921.1	9.46e-283	37	763	214	937
QTO25368.1	2.69e-282	37	763	214	937
QCT79445.1	4.35e-281	36	763	213	937
QRP89238.1	4.35e-281	36	763	213	937
QUU03487.1	1.75e-280	36	763	213	937

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SCI_A	1.57e-71	200	677	14	487	ChainA, Peptidase M60 domain-containing protein [Akkermansia muciniphila ATCC BAA-835]
5KD2_A	2.02e-63	199	761	33	605	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5KD5_A	3.97e-58	233	761	21	557	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5KD8_A BT_4244 metallopeptidase in complex with Tn antigen. [Bacteroides thetaiotaomicron VPI-5482]
7BLG_A	1.56e-40	43	190	22	162	ChainA, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLH_AAAA Chain AAAA, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLJ_A Chain A, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLK_A Chain A, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001430	0.694898	0.302524	0.000497	0.000335	0.000292

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000559_00277.