CAZyme Information: MGYG000000559_00628

Basic Information

• Species: Paraprevotella sp900546665
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900546665
• CAZyme ID: MGYG000000559_00628
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
890		100950.52	5.9224

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000559	3371833	MAG	China	Asia

• Gene Location: Start: 123643; End: 126315 Strand: +

Full Sequence      

MKICRIGFLIMALSGWMAAVSVMAAGKDRGAVAVDDMAGEWISFQPLAGAFPLVTTGATA
SLCYDADEHAGVIRAIDDLREDMLKVTGRTPRVAVGTGGSLPVIIGSMDRSSMIAGLVRQ
GKLKRDDLEGRWESYVIAVVDRLWDGADRALVIAGSDKRGTIYGIYELSRRMGVSPWYWW
ADVPVRHHDEVYVLPGYRASGEPAVKYRGIFINDEFPCLTAWARERFGGLNSRFYARVFE
LLLRLKANTLWPAMWGSFREYKPLVSVMHDDDGLYAGNCFNEDDPENPRLADEYGIVIGT
SHHEPMQRSQQEWIRHRQDYGNGEWNWLTNRKAISRFFAEGIARAKNYESMVTIGMRGDE
DRPMTDAGSREANFRVMEDIIGRQREIIRKATGRPARETPQVWTLYSEVMDYYDDGLKVP
DDVILMLCDDNFGHVRRLPDLKRKPHPGGYGMYYHVGYYGAPRASKWLSVSTVAEMWEQM
QMTYAYGVDRFWILNVGDIKPHEYLTDFFMEMAWNPGRFRHDNLGDYARDFCAQQFGEEQ
ANETAELLTAYGRYASRVTPEMLDAQTYNLQSGEFKAVRDEFMALEARALRQYLTLEEAW
CDAYRELVLFPIQGMANLYDLYYALAMNRRLAAEGSTEANRWADRVEACYRQDSLWCRAY
NREVAGGKWNHMMDQVHIGYESWHAPRHNRMPQVERVDSGACGSNPCGGYVFRQKDGVVA
MEAEHAFGCRPADGTEWVVLEGLGRTRSGLLLMPYTRDAEGAALEYRMELYTEADSVDVY
LTFGAVMPFLRGGHHVAVSLDGGAEQVVCLNRDLTWENKYTLMYPTGAARVIEKKVRLPL
GTASAGCHSLVCRPLQPGIVWERITVDCGGYEPSHLGMPESPYRRAAWGK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	49	864	1.2e-261	0.9971305595408895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	201	562	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	2.96e-31	709	880	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.001	88	168	49	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDO10801.1	0.0	32	885	18	844
QRQ55179.1	0.0	32	885	18	844
SCV07743.1	0.0	32	885	18	844
ALJ48335.1	0.0	32	885	15	841
APS38643.1	0.0	60	885	55	851

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	6.98e-297	40	885	33	853	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	7.13e-275	51	885	17	838	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	1.02e-271	51	885	16	837	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	3.77e-172	41	700	5	637	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	5.54e-117	53	697	12	658	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000363	0.998932	0.000194	0.000174	0.000156	0.000152

TMHMM  Annotations     

start	end
7	26