CAZyme Information: MGYG000000559_00634

Basic Information

• Species: Paraprevotella sp900546665
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900546665
• CAZyme ID: MGYG000000559_00634
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850		97439.55	6.4737

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000559	3371833	MAG	China	Asia

• Gene Location: Start: 139137; End: 141689 Strand: -

Full Sequence      

MKTITNTFKTLALAVMAIPVHSLAAEQFVRFGIKDNAVPICQNGQTADIVVDPDEFKGVT
IAARSLADDFMRVTGQKAGLEQQADDDEVQIIVGSMDRSDLIRQYIRQGLIDGKLLKGKR
EAFVVCTVNSPQHGRKVVIAGSDQRGTIYGIYELSRQMGVSPWWWWADVPTQKQQQISIL
PGTFTDGEPAVRYRGIFLNDEAPCLTTWAANTFGNPPGGHRFYERGFELILRLKGNFIWP
AMWSWAFYEDDPLNSRTAQDMGIIVGTSHHEPMGRNHQEWVRRRKQFGAWNYRTNRDTIR
NFFRYGIERIKDTEDLVTIGMRGDGDEAMSDKTDVELLEEIVRDQRKIIREVTGRPADKT
PQVWALYKEVMQYYEAGMKVPDDVTMLLCDDNWGNVCRVPNAKERKHPGGWGIYYHVDYV
GAPRNSKWLNCTPPAHMWEQLDLAYEAGIDRIWILNVGDLKPMEYPITLFLDMAWNPRQF
TADNLPQHAERFCSETLGSEHASEAARLLTEYARFNGRVTPEMLDHRTYNLENGEWDRVC
AEYTALEADALRLYNHMEAQRRDTYRQLVLFPIQAMANLYRMYHAQAMNLHLAKMNMPEA
NIWADRVEEAFRLDSMLCREYNRDIAGGKWNGMMIQKHIGYTSWNDSFKKDICPATRRVE
DTDRNGGYVFMPEGGYAAMEAPHYFEAVPTEGTQWTFIAGIGRTLGGMALRPYDRKAEGA
ALKYRLRLPEGTDSATVHVVVRSTLACFRPEGHRYRIGFEGGAQETVNFNHNLNERPENV
YTVYYPTVARRVIEKTVRIALPEADAEGWHTLVFRPVEPGTVLEKIVVDYGGYSPSYLFM
QESPCRRLPR

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	36	826	6e-271	0.9971305595408895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	187	523	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.13e-34	669	842	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	6.76e-04	33	154	8	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUR44901.1	0.0	18	847	13	842
QUT78586.1	0.0	18	850	13	845
QDM11119.1	0.0	18	850	13	845
QUT26893.1	0.0	18	847	13	842
ALJ48348.1	0.0	18	850	13	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	18	850	24	856	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	0.0	40	848	19	839	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	0.0	40	848	18	838	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	3.92e-184	35	690	11	664	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	4.60e-111	91	651	65	652	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000382	0.998874	0.000191	0.000185	0.000173	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000559_00634.