CAZyme Information: MGYG000000559_01302

Basic Information

• Species: Paraprevotella sp900546665
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900546665
• CAZyme ID: MGYG000000559_01302
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768		87160.22	6.2116

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000559	3371833	MAG	China	Asia

• Gene Location: Start: 63980; End: 66286 Strand: +

Full Sequence      

MRRLVYLLCFSMLGLRGMADDVIKTPQPQLTYLPLADVRLISGPFLHAEQKDAEWLLSLE
PDRLLNGFLVNAGLEPKAPKYGGWEAGGLAGQTFGHFLSACSMMYASSGDERFKAIADYC
VDQLNTCQQNVGTGMLAGFPDASRLFDELSEGKIYSKGFDLNGYYVPFYNMHKLCAGLSD
AYYHTGNETAKDVLVKLATFMNQILSPLSDAQIQTILQAEHGGINESLAEVYALTGDKRF
LTLSERLNHQDLVKPLLDRKDELASKHANTQIPKIVGVAREYELTGNKDYWNIASFFWHT
VVGHHTYVIGGNSEAEHFGASGRTYDRITDKTCETCNSYNMLKLTKHLFAFTQDMEMADF
YERVLYNHILASQNPDNGMICYMSPLASGCRKEFSSPFDSFWCCVGTGLENHARYGEFIY
ATDKLDNLYVNLFIPSELNWEKRKVTLRQITDFPESDTIRYEMSMDDSQRFTLNLRYPGW
CKEECVLKINGKLQSLGKARPGHYIPLKRKWKNGDRIELVIPQSISSEEALGDSTLRAYL
NGPIVLAAALEDGNNDVPVVVTEDLKDAGGIVKKVSGHNFEMEKVWPQTVQMKPYYLSTG
DRTVVYFEHYTPELWNQRKEQVLKQRNKEEWIRQQTVSHFQPGEMQPERDHLFDGVNLEL
GEIQGRKYRKAVDGGSFSFQMDVIPDVPMDLMCTYWGNLGDIYKFVVEVDGTPVSTVIIH
WWGNQFIDKTYHIPAEVTRGKNKVKVTFRALDAKSVAGPLFDCKILKH

Enzyme Prediction     

No EC number prediction in MGYG000000559_01302.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	37	547	3.2e-196	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	37	547	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.80e-132	26	559	5	511	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEM13389.1	8.46e-224	29	767	36	778
QIX60435.1	5.52e-222	34	767	51	789
SNV45513.1	1.36e-219	29	767	36	779
ADY34343.1	1.50e-219	29	767	39	782
QUT77212.1	2.09e-212	18	767	33	788

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	4.05e-160	29	767	24	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.31e-154	29	683	24	722	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	2.68e-23	140	566	96	580	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	7.74e-22	140	566	96	580	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	9.17e-19	157	530	180	586	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	3.33e-14	97	557	81	576	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000389	0.998866	0.000221	0.000195	0.000168	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000559_01302.