CAZyme Information: MGYG000000559_02160

Basic Information

• Species: Paraprevotella sp900546665
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900546665
• CAZyme ID: MGYG000000559_02160
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1027		117327.2	6.8019

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000559	3371833	MAG	China	Asia

• Gene Location: Start: 15012; End: 18095 Strand: -

Full Sequence      

MKKSIELKWWLVWAILFVFPFSVKSKTFVHPGVLHTKERFEQIRSLVENKTEPAYGSYLL
LKAHPFSQSDYKMRGPFEWIARDGQHRRTKDRMEADFSAVYQNALMWMLTKDKAHARKAV
EILTAYAHQLKGIPDTNDAPLLAGLEGFKIIYAMEVLKYSRSSMSEQEYRDIRDMFIRVF
LPVLDTFYKRTPYTNGNWGAIVTKAYMAAAIHLDNAGMYEKAMAFYLKGKDNGTILHYID
ETTGQIQESGRDQSHCMLGLGALATVCELAWQQGDDLYAALDNRLMKGYEYVARYNLGYD
VPFHTWKDITGKYCDWTEISEKARGRYMYVFDIAYNHYVNRKGYAMPYTRSVLEQIRPEG
YDRDQPAFGTLLFNESELPRPFVHPGGLHTMADLDRMKSMVAKGEHPWVEGWNELLKDPL
AQNTFVSKAFSNLGRSRQRASIEAHAVYLNTIRWYISGDESYAKCAIDICNAWSSVVDQV
PTKIEESGLDAIPIAEFAMAAEILRISDLWKKEDFERFCRMMKTYWYPVCRDFLRYHNGA
NVDYYWTNWDACNMMALVSIGILCDDRQIYEEGINYYKNGLGNGNIRNAVPYLHRMPDGS
VWGQWQESGRDQEHAQLGVGFMASICQMVWNQGEDLYAYDHNRLLAGAEYVAAHNQMRPV
PFTAYDNSQSLQNYWGSVNGLGSLGGRPIWEMIYNHYEVLKGIPAPNSKRMAELLRPEHG
SKDHFGYGTLTFTLKPSNYPPLPVPEVPQELKATPAASKIYLEWQPSAGYFASGYCIQRA
DKGTEDYVTIAEFDEKIMTNYTDRTVEAGKAYTYRVAAVNKTGQSRFSETVTAAPFQTEP
LSADWNLTQIGGLDSTQVTFSPQNGQTFVIKAKQGTFGGTADKMPLVNQTVKGNFTMTCR
ILDVSGAYHEIGILARPSMKEQARSVSLTLGHWGGRFARMGWRKSEGEAMKFVDGNSYTW
VPAWFKLVRCGDVFYAYQSCDGDNWIFIHAEKVEMSDECMVGLTACFKTDNERNKVEFDH
VMLTHNP

Enzyme Prediction     

No EC number prediction in MGYG000000559_02160.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05426	Alginate_lyase	3.48e-16	444	654	58	267	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
pfam05426	Alginate_lyase	1.55e-15	65	295	18	267	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
cd00063	FN3	2.10e-08	745	833	1	91	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
pfam07081	DUF1349	4.49e-05	890	1025	35	168	Protein of unknown function (DUF1349). This family consists of several hypothetical bacterial proteins but contains one sequence from Saccharomyces cerevisiae. Members of this family are typically around 200 residues in length. The function of this family is unknown.
smart00060	FN3	5.49e-05	745	825	1	83	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXP82777.1	1.32e-200	382	1024	38	677
QUT56879.1	6.42e-157	22	412	24	428
QQY39805.1	2.46e-156	22	412	24	428
ABR37862.1	2.46e-156	22	412	24	428
AXP82778.1	4.90e-148	382	1024	29	676

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000212	0.999185	0.000170	0.000142	0.000139	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000559_02160.