CAZyme Information: MGYG000000559_02670

Basic Information

• Species: Paraprevotella sp900546665
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900546665
• CAZyme ID: MGYG000000559_02670
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583		66465	9.3561

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000559	3371833	MAG	China	Asia

• Gene Location: Start: 4263; End: 6014 Strand: +

Full Sequence      

MANIKHTVCTLAVFLSLAFSSHAQVENSFIHTIKEGETVYSISRIYNVTTDDILRLNPDA
IGGIRQGDQLRIPQQKRTATNKNRFHTIAAGETLYQLTKKYGVSADDICQANPGLTAQNF
KVGMVISIPEKKSAAQSGNATNPIYKPKFKDLHKVERKETIYKIALDYNVTIEDILKLNP
EIKAPDYKLKKGEFIRIPYSRDELAKQDKKEKTPTNEELISAKKEKAPQNMVRMGVILPL
KSQHSESDKMIEFYRGVLMAVDSMKKNGLSVNVYTFDSGKSAGDIKDVLKNQTLANMDFI
IGPLYTGQINPLNEFCKKHGIKLIVPFSSAGEAVYNSPNYFAVTPPKSFQQAEACELALK
VFKKQNYIFVDSKESDEDGASFTDALEKLLQQNDINSKTIAIDADEFAWLRVFTRFQTNI
IVPNSSSVKLINKLVPILDKFSKEYPEYKVKLLGYPEWQTYTNKHLENFYRFDTYAYSAF
YKNPLTKKSKEFNATYQHNFHKPTIPAYPCFGMLGFDLTYYFLKGFSSYGDGITSHLSQI
KTSPYQHQFDFERISNWSGFINKEMQFIHYAPSHTIELIRLNP

Enzyme Prediction     

No EC number prediction in MGYG000000559_02670.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	4.19e-09	84	128	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
cd00118	LysM	5.91e-09	30	72	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
COG0683	LivK	1.41e-07	232	396	11	178	ABC-type branched-chain amino acid transport system, periplasmic component [Amino acid transport and metabolism].
pfam01476	LysM	2.32e-07	86	129	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd06268	PBP1_ABC_transporter_LIVBP-like	3.52e-07	235	523	3	287	periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type 1 periplasmic binding fold protein superfamily. Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type 1 periplasmic binding fold protein superfamily. They are mostly present in archaea and eubacteria, and are primarily involved in scavenging solutes from the environment. ABC-type transporters couple ATP hydrolysis with the uptake and efflux of a wide range of substrates across bacterial membranes, including amino acids, peptides, lipids and sterols, and various drugs. These systems are comprised of transmembrane domains, nucleotide binding domains, and in most bacterial uptake systems, periplasmic binding proteins (PBPs) which transfer the ligand to the extracellular gate of the transmembrane domains. These PBPs bind their substrates selectively and with high affinity. Members of this group include ABC-type Leucine-Isoleucine-Valine-Binding Proteins (LIVBP), which are homologous to the aliphatic amidase transcriptional repressor, AmiC, of Pseudomonas aeruginosa. The uncharacterized periplasmic components of various ABC-type transport systems are included in this group.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR76804.1	2.17e-144	23	582	22	600
ALA74972.1	3.06e-144	16	582	17	600
QJR68229.1	4.33e-144	16	582	17	600
QJR60047.1	4.33e-144	16	582	17	600
AII69224.1	4.33e-144	16	582	17	600

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8CMN2	9.34e-10	15	198	15	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q5HRU2	9.34e-10	15	198	15	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q6GJK9	7.36e-07	31	179	29	186	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=sle1 PE=3 SV=1
Q2G0D4	3.62e-06	18	141	16	145	Probable autolysin SsaALP OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_00671 PE=1 SV=1
Q7A7E0	4.07e-06	31	179	29	186	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain N315) OX=158879 GN=sle1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000225	0.999070	0.000196	0.000167	0.000163	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000559_02670.