CAZyme Information: MGYG000000560_00557

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000000560_00557
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		43104.9	7.1399

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000560	2185840	MAG	China	Asia

• Gene Location: Start: 6048; End: 7214 Strand: +

Full Sequence      

MQTQENTVQRDGAVWLAGEASGDLIASMVIPEVQRRMEGALQYGIGGPKMRDVGFRCWHD
INELSVRGYVEVLAHLPRLLKLRRSLGGRIADSLPRVFVGVDAPDFNLGLETELRRRQIP
VVHLVSPSIWAWRPERIQTIRRAVDHMLLVFPFEEEIYRKAGIPATFVGHPLASMIPEEP
DTVGARTALNVPLNDRVLTVMPGSRASELSGCAPIFFDAVERLMKRSGPVSVIVPAIDDQ
AKASLEQLANQYPRLAERLTVVVGQSHRAIEASDAVLVASGTAALECALYKKPMVVGYKM
PGFTGLLMEKKGLIDYVSLPNILARERLVPEFLQYFCEPDAISWSIEDALTNDKRRAYLV
ERFQAMHASLKADTANLAADVICQYARH

Enzyme Prediction     

No EC number prediction in MGYG000000560_00557.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	16	371	5.2e-115	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	7.07e-157	17	382	8	371	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.04e-131	17	387	8	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.37e-97	17	356	5	345	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	9.40e-89	7	382	2	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	1.38e-38	17	333	233	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF22932.1	1.29e-181	7	386	9	388
QDA54177.1	2.91e-180	7	382	9	385
QQS88891.1	1.68e-174	8	382	9	384
ANU65980.1	2.07e-124	14	382	10	377
QQQ97139.1	2.07e-124	14	382	10	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	6.49e-83	16	387	12	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.83e-82	16	387	12	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q470F0	3.98e-122	3	387	14	397	Lipid-A-disaccharide synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) OX=264198 GN=lpxB PE=3 SV=1
Q1LNE5	2.43e-115	6	387	16	396	Lipid-A-disaccharide synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) OX=266264 GN=lpxB PE=3 SV=1
Q8XZH8	1.79e-112	17	387	16	385	Lipid-A-disaccharide synthase OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=lpxB PE=3 SV=1
Q3JR42	6.74e-112	16	384	13	380	Lipid-A-disaccharide synthase OS=Burkholderia pseudomallei (strain 1710b) OX=320372 GN=lpxB PE=3 SV=1
A3NWL7	9.54e-112	16	382	13	378	Lipid-A-disaccharide synthase OS=Burkholderia pseudomallei (strain 1106a) OX=357348 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000560_00557.