CAZyme Information: MGYG000000560_00990

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000000560_00990
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	MGYG000000560_21|CGC1	45721.91	4.9638

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000560	2185840	MAG	China	Asia

• Gene Location: Start: 17544; End: 18791 Strand: +

Full Sequence      

MKQSLLTLMLGTLFALTPAVSTTWAADTASAPAAPANADTKAETKADAKTAEAAPVLPTL
TPVRTLTNAPTDTWPAWATFRDAALEGGRVLDKSDDRIITTSEGQSYGLFFALVANDRPA
FDKIWNWTVANLCAGDCGKTRLAWLWGASESTKAPKNPITWGVIDSNNATDADLWLAYTL
LEAADRWQEPRYREDALALLNRVKQDVRVVRGIGAVLLPANVGFEKNGNVVLNPSYYPIF
ILKRLEAVDPLWKDVREGSMRALIRSAESGLSPDWVAFGQRWGTRNRDESSEGSWNAIRV
YLWAGMMPQDDPDAIRLREQLAPMVDVTKRRFVTPEETDTAAFTVSKSGPLAFGACLLPW
VKDDRVGSWIRTGLATMPLTAEDYYRSVLALFGMGFDEGRFAFSHEGRLILKGDE

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	74	396	2.3e-73	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	3.61e-123	65	412	16	367	cellulase.
COG3405	BcsZ	5.31e-77	72	404	24	351	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	2.89e-54	71	399	1	321	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQS88762.1	2.65e-107	74	411	28	361
QDA53782.1	1.15e-106	74	410	71	408
QDA53874.1	2.06e-106	70	415	20	364
ANU67169.1	5.62e-95	68	414	16	353
QQQ96024.1	5.62e-95	68	414	16	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7F81_A	4.25e-86	73	409	7	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
3QXQ_A	6.78e-86	73	410	3	336	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
7F82_A	1.20e-85	73	409	7	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]
3QXF_A	4.25e-81	73	410	3	336	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]
4Q2B_A	5.00e-81	74	410	4	340	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8ZLB7	9.03e-87	74	410	26	358	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8X5L9	1.24e-86	73	410	24	357	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
Q8Z289	1.43e-85	74	410	26	358	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
P37651	1.96e-85	73	410	24	357	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
P58935	5.41e-70	74	410	33	372	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000396	0.998815	0.000211	0.000203	0.000167	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000560_00990.