CAZyme Information: MGYG000000561_01172

Basic Information

• Species: CAG-115 sp003507295
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-115; CAG-115 sp003507295
• CAZyme ID: MGYG000000561_01172
• CAZy Family: GH5
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		43163.11	5.2783

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000561	2687682	MAG	China	Asia

• Gene Location: Start: 66381; End: 67547 Strand: -

Full Sequence      

MGLLSKITAFVTAMTVMAGSGTSQADKIFDKYILDSTSGSASGNSSEALSAPVDPVELSK
GITIGWNLGNSLDATGSGMNSETSWGNPKTTKSLILKVKEAGFNAVRIPTTWFNHSDSEL
NVDSVWFDRVQEVVDYAYDEGMYVILNAHHEDWYDPYESNLTSARRKMKNLWTQIANRFK
DYGERLIFEGMNEPRWRSTNWEWNGGNSEGRSAVNKLNECFVKAVRATGGNNSYRALMVP
TYAASASGLDGFTLPADSSLIVSVHAYSPYNFAMNENGTTSFDPDDVNSTGELTWLADTL
YDRFVSKGTGVIIGECGTVNKNNLSDRMNWAGYFPKVFGEKGIRIFLWDNNAYGYGNEKF
GLLHRDTLAWEFPDYIKKLVRTAKNYNK

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	81	351	1.6e-94	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.04e-66	72	354	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	4.41e-35	53	379	42	390	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADK66823.1	1.20e-111	41	381	19	364
CBL16772.1	3.31e-108	62	381	106	437
CBL17440.1	2.52e-103	57	385	45	378
CDM69884.1	2.90e-103	39	387	23	382
AWV80519.1	3.58e-97	44	379	34	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQP_A	6.05e-110	62	381	23	354	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
4IM4_A	2.50e-99	53	383	5	335	ChainA, Endoglucanase E [Acetivibrio thermocellus],4IM4_B Chain B, Endoglucanase E [Acetivibrio thermocellus],4IM4_C Chain C, Endoglucanase E [Acetivibrio thermocellus],4IM4_D Chain D, Endoglucanase E [Acetivibrio thermocellus],4IM4_E Chain E, Endoglucanase E [Acetivibrio thermocellus],4IM4_F Chain F, Endoglucanase E [Acetivibrio thermocellus]
6MQ4_A	3.05e-99	53	381	10	347	ChainA, cellulase [Acetivibrio cellulolyticus]
3NDY_A	2.78e-95	64	381	21	339	Thestructure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDZ_A The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans]
6Q1I_A	1.63e-94	57	385	16	355	GH5-4broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum],6Q1I_B GH5-4 broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q12647	7.33e-96	57	385	27	365	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P10477	2.68e-93	53	383	55	385	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
P23661	3.13e-93	3	386	6	399	Endoglucanase B OS=Ruminococcus albus OX=1264 GN=celB PE=3 SV=1
P28623	1.18e-92	39	381	27	370	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P54937	1.25e-92	57	385	41	380	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000513	0.998760	0.000195	0.000189	0.000158	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000561_01172.