CAZyme Information: MGYG000000562_01232

Basic Information

• Species: Lachnospira sp000437735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira sp000437735
• CAZyme ID: MGYG000000562_01232
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000000562_4|CGC3	35387.61	5.2425

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000562	2986625	MAG	China	Asia

• Gene Location: Start: 220334; End: 221272 Strand: -

Full Sequence      

MITVAKDGSGDYTSVQEAIDSITSVPETVFIKNGIYKERVEIHKDNITLIGENADGTVIT
NNYYAFMPMEDGSKRGTFRSYTFFVQANHFNAYNITFENSAGFGKKVGQAIAVYAEGDDL
VFKNCHMLGHQDTLFTGPLPMKEKQPGGFVGPTEFAPRIPGRQLYEDCFISGEVDFIFGS
AICYFKNCELYALNRNETINSYYTAPSTYEGQKYGYVFESCSFSGNCPPRTTMLSRPWRI
YAKVVLIRCDLSEQVSETGFHDWNKPESHETCYYAEYACTGKGYVPERRPDYVHQLTERE
AGEYTREKVFGR

Enzyme Prediction     

No EC number prediction in MGYG000000562_01232.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	2	310	8.4e-91	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	6.98e-71	1	310	83	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	5.70e-63	2	305	2	290	Pectinesterase.
PLN02773	PLN02773	1.66e-54	1	304	6	290	pectinesterase
PLN02682	PLN02682	1.25e-51	2	301	71	352	pectinesterase family protein
PLN02432	PLN02432	1.07e-50	1	301	12	277	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR72174.1	1.57e-157	1	309	1	310
SET76962.1	6.41e-111	1	309	1	312
QRP39805.1	1.31e-110	2	311	18	342
ASN95501.1	1.31e-110	2	311	18	342
ADZ82949.1	8.78e-109	4	309	3	311

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	3.42e-33	2	283	9	272	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	1.45e-32	4	311	7	335	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	2.16e-30	11	238	43	269	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1XG2_A	6.80e-30	4	298	7	285	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1QJV_A	1.42e-26	4	311	7	335	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.08e-42	1	304	6	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
O49298	7.51e-40	2	305	251	532	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
Q43043	1.21e-38	3	289	60	329	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
Q8L7Q7	4.22e-38	2	305	289	587	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q84R10	8.96e-38	4	305	208	497	Probable pectinesterase/pectinesterase inhibitor 36 OS=Arabidopsis thaliana OX=3702 GN=PME36 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999316	0.000705	0.000014	0.000001	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000562_01232.