CAZyme Information: MGYG000000566_00691

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Mailhella
• CAZyme ID: MGYG000000566_00691
• CAZy Family: GH103
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		36648.42	9.9355

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000566	1581307	MAG	China	Asia

• Gene Location: Start: 1642; End: 2640 Strand: +

Full Sequence      

MRSYRLVMVFLGILALSASGCSKSTLQTPSASVPNRPVSSMEFSDQTASWHEAWQNLSVK
LQIDGLDTVRTNALFARLDMPPSAVPMGIKVKELYTNKFLPRPKAQPQKTFKTKLGIPGP
WFKGVVTTANAKKCRDFIDQHAVAFARAELNYGVPSEVAAALLFVETRLGGYLGKHNAFY
MLASMAVTRDPADIPEYMSKLPGSEGQIPWIREKMAVKADWAYKELKALLSYCYANGIDP
LKVKGSVYGAMGLCQFMPSNISRYGVDGNADGVIDLFTVDDAVASLSNYLRRNGWRSGLS
VTQQTRVLRTYNAMDIYAHTILALARTIRQLG

Enzyme Prediction     

No EC number prediction in MGYG000000566_00691.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	119	306	3.3e-47	0.5457627118644067

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13406	SLT_2	4.17e-53	49	332	1	237	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
COG2951	MltB	2.26e-38	5	326	4	278	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
PRK10760	PRK10760	9.35e-30	116	301	107	269	murein hydrolase B; Provisional
cd13399	Slt35-like	2.63e-24	245	327	24	108	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd00254	LT-like	0.003	249	313	23	80	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADP85790.1	1.33e-91	2	325	9	327
AAS95158.1	1.33e-91	2	325	9	327
ABM29301.1	3.76e-91	2	325	9	327
QCC86237.1	1.21e-89	54	325	127	391
ATD81641.1	2.67e-89	47	330	102	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O8X_A	2.47e-21	126	307	61	217	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	3.14e-21	126	307	78	234	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
1LTM_A	1.34e-19	107	298	59	227	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]
1D0K_A	1.37e-19	107	298	61	229	ChainA, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0L_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0M_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1QDR_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QDT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUS_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	1.15e-18	107	298	100	268	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000053	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000566_00691.