CAZyme Information: MGYG000000566_01416

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Mailhella
• CAZyme ID: MGYG000000566_01416
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		36032.26	5.7656

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000566	1581307	MAG	China	Asia

• Gene Location: Start: 565; End: 1545 Strand: -

Full Sequence      

MELPFNSQTPGGLLELVRGMDGLVREFGPDVVNCHRGEAFVLWALMKKRYGFALVRTRGD
RRLPRGGFVNRWLHCRAADAVIATNSLMTRHFSEALHVPSDKLYTILGGVDTARFHADRQ
AGAEVRRRYGFSENDVVMGLLGRMDEVKGIRETVAALAKARKLSPEAERIRFLVIGFDSE
FTTEDVARWSREQGLGELDGIVTVTGRVENPEEVINALDFGILASLGSEAIARAALEIMA
SGVPLISSTTGVMPDLLPPQYCFAPGDTQAMAERMVQAMDEDWRAELAQVCVDRVFKGGL
RLEDFLEASLNVYDRAIRSASRTSVL

Enzyme Prediction     

No EC number prediction in MGYG000000566_01416.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	131	284	1e-16	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.38e-33	13	295	67	348	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03807	GT4_WbnK-like	2.43e-30	10	285	65	335	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
cd03819	GT4_WavL-like	2.23e-26	1	289	49	329	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.
cd03808	GT4_CapM-like	8.10e-22	13	295	70	344	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03798	GT4_WlbH-like	1.15e-20	24	287	91	348	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACU88358.1	1.04e-90	3	314	57	363
ABB38453.1	1.67e-89	3	316	57	366
AAS96355.1	6.69e-89	3	317	49	357
ADP86584.1	1.35e-88	3	317	72	380
ABM28304.1	1.35e-88	3	317	72	380

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D3Q051	8.07e-08	78	251	187	360	D-inositol 3-phosphate glycosyltransferase OS=Stackebrandtia nassauensis (strain DSM 44728 / CIP 108903 / NRRL B-16338 / NBRC 102104 / LLR-40K-21) OX=446470 GN=mshA PE=3 SV=1
D6Z995	8.12e-07	30	290	139	398	D-inositol 3-phosphate glycosyltransferase OS=Segniliparus rotundus (strain ATCC BAA-972 / CDC 1076 / CIP 108378 / DSM 44985 / JCM 13578) OX=640132 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000566_01416.