CAZyme Information: MGYG000000567_01794

Basic Information

• Species: CAG-521 sp000437635
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521; CAG-521 sp000437635
• CAZyme ID: MGYG000000567_01794
• CAZy Family: GH102
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000000567_12|CGC1	43042.37	9.3156

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000567	1906485	MAG	China	Asia

• Gene Location: Start: 4025; End: 5191 Strand: -

Full Sequence      

MRLSRICLFTAIASLLAACTTTPPEKPTKPGEVKLSLKPVDYAQLPAMPEENWQPALAAF
KESCEKMASRPGWEEVCAKAKFLPLNQAKTFFSAYFTPYQAIAETVDQSGMVSVSDSGKM
TGYYEPILYGSRKKKTPYIYPLHTMPSDLITVDLAEIYPQLKGMRLRGQIEGNRLVPYDS
RAQLAKRNLDKYAIAWVEDPVAAFFLQVQGSGRIVLPDGSYMRVGYGDVNGHPYRGIGNY
LVRQGFLKSHELSMQSIQAWAKKNPKKVQAVLNQNPSYVFFIERKDQDPNEGPIGAQGVP
LTEKGSVAVDRRYYQLGWPIIVDVEQSNPDMKFTRAVVAQDTGGAIKGPIRFDFYWGSGD
EAALAAGKQNSQVKAWVLLPNGVTPQAN

Enzyme Prediction     

No EC number prediction in MGYG000000567_01794.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH102	129	281	1.6e-57	0.9808917197452229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03562	MltA	3.20e-99	50	281	3	230	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
COG2821	MltA	1.54e-95	1	387	4	372	Membrane-bound lytic murein transglycosylase [Cell wall/membrane/envelope biogenesis].
cd14668	mlta_B	2.31e-79	128	284	1	159	Domain B insert of mltA_like lytic transglycosylases. Escherichia coli MltA is a membrane-bound lytic transglycosylase comprised of two domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, which correspond to the 3D domain, named for 3 conserved aspartate residues. Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial lytic transglycosylases (LTs), which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond. Typically, peptidoglycan lytic transglycosylases (LT) are exolytic, releasing Metabolite 1 (GlcNAc-anhMurNAc-L-Ala-D-Glu-m-Dap-D-Ala-D-Ala) from the ends of the PG strands. In contrast, MltE is endolytic , cleaving in the middle of PG strands, with further processing to Metabolite 1 accomplished by other LTs. In E. coli, there are six membrane-bound LTs: MltA-MltF and soluble Slt70. Slt35 is a soluble fragment cleaved from MltB. Bacterial LTs are classified in 4 families: Family 1 includes slt70 MltC-MltF, Family 2 includes MltA, Family 3 includes MltB, and Family 4 of bacteriophage origin. While most of the LT family members are similar in structure and sequence with a lysozyme-like fold, Family 2 (including mltA) is distinct.
smart00925	MltA	1.67e-71	127	281	1	152	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
PRK11162	mltA	9.30e-53	8	378	10	354	murein transglycosylase A; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF22454.1	1.95e-152	11	386	12	391
ANU66434.1	1.56e-140	13	386	17	397
QQQ97583.1	1.56e-140	13	386	17	397
QDA55021.1	1.13e-133	11	386	24	392
QQS89395.1	7.39e-130	30	386	40	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2G5D_A	1.63e-81	40	386	45	419	Crystalstructure of MltA from Neisseria gonorrhoeae Monoclinic form [Neisseria gonorrhoeae FA 1090]
7ESJ_A	4.01e-80	19	383	2	362	ChainA, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii],7ESJ_B Chain B, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii]
6QK4_B	6.59e-80	30	381	17	347	Lytictransglycosylase, LtgG, of Burkholderia pseudomallei. [Burkholderia pseudomallei]
2G6G_A	1.13e-78	40	386	45	419	Crystalstructure of MltA from Neisseria gonorrhoeae [Neisseria gonorrhoeae FA 1090]
3CZB_A	4.73e-52	40	381	10	342	Crystalstructure of putative transglycosylase from Caulobacter crescentus [Caulobacter vibrioides CB15],3CZB_B Crystal structure of putative transglycosylase from Caulobacter crescentus [Caulobacter vibrioides CB15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8K9A7	2.97e-29	106	378	118	364	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) OX=198804 GN=mltA PE=3 SV=1
P57531	1.63e-26	119	378	117	356	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) OX=107806 GN=mltA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000056	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000567_01794.