CAZyme Information: MGYG000000568_00036

Basic Information

• Species: CAG-279 sp900544305
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp900544305
• CAZyme ID: MGYG000000568_00036
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325		37432.78	6.5015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000568	2842092	MAG	China	Asia

• Gene Location: Start: 48721; End: 49698 Strand: +

Full Sequence      

MLTHLCKYNTYFQKIGNLLIFLVLFLFSSAATVCAQSMDYLMYIEHYSETAVRHQQEYGI
PASITLAQGLLESGAGKSRLAVEGNNHFGIKCHSTWKGDVIHADDDELDECFRKYDDAAE
SFEDHARFLMKKRYAPLFELKPTDYKGWAKGLKKCGYATDPSYASKLINIIETYELYAYD
TGQPVIASRKKLQGDETLEHSIDMEIINEFKLMHKMRKKWGLYYITVYEGDTYDAIAEEF
GIKKRRLLSFNDLGRRDEMLEAGSMLYLEEKNDCVETGPETHKVKKGDTPYSIAQEYGIK
LESFLKMNGLEVDDRLRAGKKLRLR

Enzyme Prediction     

No EC number prediction in MGYG000000568_00036.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	49	176	1.8e-38	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	9.42e-46	28	192	31	200	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	7.54e-38	43	180	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	2.39e-29	49	176	2	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	1.93e-28	39	180	7	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
TIGR02541	flagell_FlgJ	9.86e-25	28	171	139	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF12398.1	4.54e-94	23	325	9	299
QCY57337.1	7.19e-78	39	325	30	302
QUT21858.1	7.19e-78	39	325	30	302
QUT55553.1	7.19e-78	39	325	30	302
ABR43831.1	7.19e-78	39	325	30	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZYC_A	6.13e-15	51	200	13	165	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3VWO_A	9.57e-15	51	171	12	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3K3T_A	4.14e-14	51	200	13	165	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5T1Q_A	5.99e-12	37	180	57	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN4_A	1.60e-10	38	194	1	168	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.05e-19	42	188	50	206	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P37710	2.75e-15	62	322	202	470	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	4.11e-11	62	311	84	367	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q2G222	5.31e-11	37	180	317	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
Q9X9J3	2.66e-10	47	175	170	306	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005035	0.991374	0.002822	0.000274	0.000247	0.000247

TMHMM  Annotations     

start	end
15	37