CAZyme Information: MGYG000000568_02070

Basic Information

• Species: CAG-279 sp900544305
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp900544305
• CAZyme ID: MGYG000000568_02070
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
758	MGYG000000568_69|CGC1	83324.2	5.0045

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000568	2842092	MAG	China	Asia

• Gene Location: Start: 3636; End: 5912 Strand: -

Full Sequence      

MKISKILFASAMMFTASAGAFAAPADAEMNKFIDDLMGKMTLQEKIGQLNLPVTGDIVTG
AAKSSNVAERIRQGQVGGLFNLKGVEKIKDVQRIAVEESRLHIPLLFGMDVIHGYETVFP
IPLGLSCTWDMEAVEKSARIAAIESSADGICWTFSPMVDICRDARWGRISEGSGEDPFLG
SRIAEAMVKGYQGDLTRNDEILACVKHFALYGAPDAGRDYNTVDMSHLRMYNEYFPPYKA
AIEAGAASVMASFNTVDGIPATGNRWLMTEVLRNQWKFDGFVVTDYTGIFEMIAHGMGDL
QQVAAMALKAGVDMDMVSDAFVGTLEKSVKEGKVSEEEINVACRRMLEAKYRLGLFDDPY
KFLDVKRPAKQIYTAENRAIAREIARESFVLLKNEGNLLPLKRKGKIALIGPLANTRANM
PGTWSVAAVSSKYSTLLEGLQNAVGKKAEILYAKGSNLMYDAKMEADATMFGREMRDNRS
NEEMLKEALEIAKKSDVIVAALGESSEMSGESSSRTNLEMPDAQRDLLEALLATGKPVVL
VHFSGRPTVLTWESENVPAILNVWFGGSEAADAIADVLFGDYAPSGKLTTSFPRNVGQVP
IFYNEFNTGRPLTGGWFTKFQTGYLDSPNTPLYPFGFGLSYTTFEYSNFTLSADSMTENG
TLTASVTVKNTGNYDADEVVQLYIRDLVGSVSRPVKELKGFERISLKKGESKTVNFTINA
ELLKFYNSNLDFVCEPGEFEVMVGPNSRDVQTKKFTLK

Enzyme Prediction     

No EC number prediction in MGYG000000568_02070.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	97	317	5e-69	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	30	757	35	764	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	2.62e-112	41	349	1	316	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	5.67e-109	40	458	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	8.03e-79	153	744	152	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	3.95e-63	390	641	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM10595.1	0.0	1	757	1	760
QUT79182.1	0.0	1	757	1	760
QRM99629.1	0.0	1	758	1	761
QGT72545.1	0.0	1	758	1	761
QUT31653.1	0.0	1	758	1	761

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXN_A	0.0	22	758	3	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	0.0	23	758	3	751	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	0.0	22	758	3	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	2.70e-238	28	757	2	732	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	5.61e-238	16	757	22	764	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	5.92e-232	32	757	37	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	8.00e-227	32	757	37	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	1.50e-140	61	758	23	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	9.03e-121	25	758	32	755	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	3.54e-116	24	753	30	774	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000234	0.999121	0.000164	0.000159	0.000149	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000568_02070.