CAZyme Information: MGYG000000571_00619

Basic Information

• Species: Pauljensenia turicensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia turicensis
• CAZyme ID: MGYG000000571_00619
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		41479.13	6.9824

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000571	1767918	MAG	Madagascar	Africa

• Gene Location: Start: 53192; End: 54313 Strand: -

Full Sequence      

MFTRSGHILQGWFQDRSSWYWADSEGRAVLGWKHINSSWYYFNSSNAMVTGWQSIGGKWY
YFTTSGAMHTGWLHNGNTWYYLDSSGAMATGWNLVNNTWYYLTQSGEMKTGWVDNGGTWY
YLDSSGAMATGWRSVNGTWYYFKTSGAMKTGWLENNGTWYYLAPSGAMVTGQQDINSATY
YFASDGTWFTPTPIMGTPQKNRATTIQAMLNAYAQSGHSYPSGALSIGGAPTALDFFSIL
YDEATAEGINPEVVFAQSMLETAWLSFGGDVKIQQFNFAGLAATGNGAQGNGFPDVRTGL
RAQVQHLRVYADPHATESSLAYPLVDQRFIYVVKGSAPIVEYLGIQENPQHRGWATGKNY
GFHIIALMKRSFS

Enzyme Prediction     

No EC number prediction in MGYG000000571_00619.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	240	370	6.6e-18	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	4.81e-75	6	172	459	625	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	5.17e-73	11	189	444	627	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	5.60e-72	31	190	444	603	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	3.13e-70	11	172	487	648	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	1.57e-63	50	190	486	626	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYB16400.1	2.55e-123	186	373	226	413
QKD80262.1	3.57e-69	192	372	209	389
QCT35925.1	9.74e-67	194	372	509	686
QGS10651.1	2.47e-66	194	372	505	682
BAW93920.1	1.37e-65	192	372	210	390

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	7.16e-17	242	340	77	171	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997665	0.002335	0.000027	0.000004	0.000003	0.000006

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000571_00619.