CAZyme Information: MGYG000000572_00097

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1
• CAZyme ID: MGYG000000572_00097
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	MGYG000000572_2|CGC2	36044.19	8.6556

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000572	1867050	MAG	Madagascar	Africa

• Gene Location: Start: 36097; End: 37083 Strand: +

Full Sequence      

MNILAINFGGIGDEIFFLPTLISLKKEYPNSKITLALEPRSKSVKDLTDVIDDLFLIDVK
GKNKYLELLKLVFLPQKGHFDMVVSSGGNKLISVLLAMTGIKQRYGYYTGKLSQILLTKA
VPLNKKQYACAMYHDLITPITAHKTELPEINVAPQEKIPNTVLIHPGVSKMSINKGMIKT
VGADVWADVVSLLLKQGKHVLLAGGPDDKEVIESILSKVDENSPNFTNYYGKTRSLKDLA
VLIGQAEKFVCSDSAPLHVGVAMKTRTYAIFGPTDDKMLIPQSDLVTAIKANDSCSIKPC
LWAHRQTTCENLDCLKITAQDIVNAVNS

Enzyme Prediction     

No EC number prediction in MGYG000000572_00097.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	76	309	2.2e-30	0.92

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	2.15e-44	1	326	2	326	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	5.14e-38	2	327	1	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	1.09e-17	3	326	8	339	lipopolysaccharide core biosynthesis protein; Provisional
TIGR02195	heptsyl_trn_II	3.91e-16	2	328	1	331	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam01075	Glyco_transf_9	8.10e-15	80	312	13	246	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38411.1	4.18e-216	1	328	1	328
BAI93916.1	4.31e-51	1	291	1	300
QNH55727.1	4.31e-51	1	291	1	300
AMW31030.1	4.31e-51	1	291	1	300
CDM95688.1	4.31e-51	1	291	1	300

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	1.03e-10	12	275	5	280	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	1.35e-10	12	293	5	298	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000572_00097.