CAZyme Information: MGYG000000572_01304

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1
• CAZyme ID: MGYG000000572_01304
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		42407.86	9.6567

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000572	1867050	MAG	Madagascar	Africa

• Gene Location: Start: 5048; End: 6166 Strand: +

Full Sequence      

MKKVFIITGEYSGDIHASHVARALKVLNPDVEIEGVGGENLRNAGVKLFSDQKKMGAVGL
SLKIITDHFLLGKRIVDYLTKEYKPDLVLLIDYGVFNLNISKFLKRAGIKVLYYIPPQVW
ASRKWRINTIKKNINEVLCIFPFEKTMYESYGIKTHYCGHPLVSQLPEKANKDEFFEKHG
FDKNKKLVAIFPGSREFELKFLMKVFIKTAQNLQKKHPDLQFCISHAPNLSDKVYDKYLK
KTDFPVIKGENQALLSVSDALILASGTVALEACLYQTPMIIAYRGPWLFYLIYLIVRCIK
RVSLPNIIADKLIVPEIIQGDVNVTKISYEIEKLLFDKEYRAQNIRDLGEVKALLSDKIS
SEEVAKVINSSL

Enzyme Prediction     

No EC number prediction in MGYG000000572_01304.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	354	1.6e-106	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.79e-119	1	371	1	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.09e-104	1	369	1	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.31e-74	4	348	1	351	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.68e-68	4	344	8	354	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	7.63e-44	1	368	1	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	1.99e-232	1	372	1	372
ASQ45794.1	3.27e-74	2	372	5	380
VEH12442.1	2.97e-73	2	372	5	379
CEK10842.1	1.48e-72	2	372	5	379
AKQ33376.1	1.81e-72	2	367	6	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	4.72e-46	4	335	9	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	9.23e-46	4	335	9	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ZVR9	6.48e-69	3	356	6	363	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpxB1 PE=3 SV=1
B6J161	4.07e-68	2	370	4	372	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	5.74e-68	2	370	4	372	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
Q83DS5	5.74e-68	2	370	4	372	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
A9NCA7	5.74e-68	2	370	4	372	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000572_01304.