CAZyme Information: MGYG000000573_00442

Basic Information

• Species: Gemmiger variabilis_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger variabilis_A
• CAZyme ID: MGYG000000573_00442
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000000573_8|CGC1	35720.84	5.2499

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000573	2095140	MAG	Madagascar	Africa

• Gene Location: Start: 8111; End: 9082 Strand: +

Full Sequence      

MQERKTILIAADGSGDFTTLTAAVQAQQADAQQPVRFYIKKGIYRERPFIELADYCLQGE
SRTETVFTAGVGGRDPWPGEEKTGTFRSYTLFLGGGRAEVRDLTVENTAGDGAKAGQALA
VYADAARVYMQNVTLLGNQDTLFTAPLPAQEREKNGFRGPRQDTPRLDTVQYYRNCTIRG
NIDFIFGGANAVFDHCRIEPWRHAKPVSYITAPSTPAGQPGYLFVDCTVQGNCPADSVYL
GRPWRKDAACCWLHCRLSEEIHPDGWDNWNNPENETTARFAEYENTGRGAAAARAFGTVN
APETLQKQLENLTALRAMFDVEG

Enzyme Prediction     

No EC number prediction in MGYG000000573_00442.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	7	295	2.2e-73	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.70e-47	36	283	112	372	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02773	PLN02773	2.15e-38	1	283	1	263	pectinesterase
pfam01095	Pectinesterase	4.50e-37	7	286	2	262	Pectinesterase.
PLN02416	PLN02416	2.95e-35	5	285	230	491	probable pectinesterase/pectinesterase inhibitor
PLN02708	PLN02708	3.15e-32	39	286	276	513	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB27671.1	5.66e-84	6	290	3	285
CBL01447.1	5.66e-84	6	290	3	285
QIA44050.1	2.28e-81	7	290	4	285
ATP00222.1	2.28e-81	7	290	4	285
AXA81880.1	2.85e-80	6	291	3	286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	4.65e-28	7	293	9	276	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.02e-22	8	294	6	273	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	1.72e-21	16	291	43	336	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	7.20e-19	17	294	18	315	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1C_A	1.00e-17	15	290	17	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O49006	2.80e-31	9	307	284	568	Pectinesterase/pectinesterase inhibitor 3 OS=Arabidopsis thaliana OX=3702 GN=PME3 PE=1 SV=2
Q43043	6.68e-30	9	291	61	325	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
Q9FF78	1.39e-29	1	320	252	548	Probable pectinesterase/pectinesterase inhibitor 46 OS=Arabidopsis thaliana OX=3702 GN=PME46 PE=2 SV=1
Q9LVQ0	3.41e-29	1	293	1	273	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8L7Q7	4.24e-29	7	290	289	566	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000573_00442.