CAZyme Information: MGYG000000573_01795

Basic Information

• Species: Gemmiger variabilis_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger variabilis_A
• CAZyme ID: MGYG000000573_01795
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330		37028.13	5.8662

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000573	2095140	MAG	Madagascar	Africa

• Gene Location: Start: 2533; End: 3525 Strand: -

Full Sequence      

MLEKHIGSGFRKDAAELEKLLTFAEDEGVLNELTAVKSANKQALADWLLHTQNVKVNTQA
VFDIQSKRLHEYKRQQLNLLYLIHQYYEIKAGHLPAVPLVSIFGAKAAPAYTIAKDIIHA
LLTFSKVIAQDPEVSPWLQVVFVENYNVTAAEKLIPACDLSEQISLASKEASGTGNMKFM
LNGALTLGTMDGANVEISQQVGQENVYIFGQTSDQVIHRYDAGDYVAAQWYEGDPNIRRA
VDFLTGPQMLAAGQQENLQRLQNELIQKDWFQTLPDFNAYVVRKGQALSDYACDPMGWRR
KCLVNIAKAGFFSSDRTIAEYDRDIWHLGK

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	2	328	2.5e-105	0.46142433234421365

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00343	Phosphorylase	0.0	2	328	337	661	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.
cd04300	GT35_Glycogen_Phosphorylase	3.48e-164	4	328	472	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0058	GlgP	1.09e-114	6	330	433	750	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	1.45e-101	17	326	486	794	maltodextrin phosphorylase; Provisional
PRK14986	PRK14986	2.51e-92	1	328	484	810	glycogen phosphorylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB27758.1	5.81e-208	2	330	425	753
CBL01526.1	8.24e-208	2	330	425	753
CCG34911.1	6.67e-207	2	330	425	753
QIA42218.1	7.66e-206	2	330	425	753
ATO99388.1	7.66e-206	2	330	425	753

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4L22_A	6.33e-124	2	327	432	756	Crystalstructure of putative glycogen phosphorylase from Streptococcus mutans [Streptococcus mutans UA159]
2C4M_A	7.03e-88	13	328	469	788	Starchphosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_B Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_C Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_D Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae]
3CEH_A	1.91e-76	1	328	480	805	Humanliver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEH_B Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEJ_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEJ_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEM_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens],3CEM_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens]
1FA9_A	3.31e-76	1	328	502	827	HUMANLIVER GLYCOGEN PHOSPHORYLASE A COMPLEXED WITH AMP [Homo sapiens]
1FC0_A	3.31e-76	1	328	502	827	HUMANLIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],1FC0_B HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],2ATI_A Glycogen Phosphorylase Inhibitors [Homo sapiens],2ATI_B Glycogen Phosphorylase Inhibitors [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29849	5.91e-123	2	328	427	751	Maltodextrin phosphorylase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malP PE=3 SV=2
Q0VCM4	2.67e-76	1	328	503	828	Glycogen phosphorylase, liver form OS=Bos taurus OX=9913 GN=PYGL PE=2 SV=1
Q3B7M9	4.61e-76	4	326	506	826	Glycogen phosphorylase, brain form OS=Bos taurus OX=9913 GN=PYGB PE=2 SV=3
P53534	1.61e-75	1	326	503	826	Glycogen phosphorylase, brain form (Fragment) OS=Rattus norvegicus OX=10116 GN=Pygb PE=1 SV=3
P06737	1.84e-75	1	328	503	828	Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000573_01795.