CAZyme Information: MGYG000000574_00004

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000000574_00004
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2164		239382.23	4.368

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000574	5306470	MAG	Madagascar	Africa

• Gene Location: Start: 11987; End: 18481 Strand: +

Full Sequence      

MNRKWKRMTACALAAVVAATSFGIPGAKKEAEAAYTTGNAPYINTWLVAGPSDTSVTDAI
YEDVAAPVERPEDGNWARVAKVSATSSWQNGPYSYPDRTDSPSAKNNVDKAVDGDKNTCW
LAQMHDAEGAPESWPKWDPAPTYYLEWKTPIQVKTVEFFDRYDSGWGDRHISEIEEVKVT
LKNAKDEVLAEQTVTDINHKGETPGVAAFDTAVQDVSKIELLIVHDGVKDLRNVGLGFSE
INVFDGEKTEEPGQGEDPEGTKLEVSSASASTTLSGSSASYAVDGDMDTAWKSDTRQGIV
WDDALTLTLDLAEVAQITQIKINGFERDNKQLNVTYTLLDEDGAPIKEVSQSSIVNTDFT
ATAITKAYNVKTVKAKIRETGGAPNHLGIKEIEVYGIAGKTEAPEEPEEEPAIQISPKLG
DTFGDARWEYFDDRIFNRNLDDWQDLYGYYTVKKGISTENKYVYAHTYVYSPKKQTVNLR
MVTSGLHKVYVNDKLVHQNDTAVESSNKDQYRQSVTLKEGWNKLLIEVQHTRVHYLGFYA
RLCDKDGNEVKDLIYSVMGDQEESLQIVTQGLDIDRTAFEERNQEIPSNMYPENELPYGY
TQWPYVWNKPIHRTNNWAPQASGFRFQAAGGAPAYTWEIVEGQLPDGLTMDDNGVLDGYC
ETAGEYPFTLQVTDAEGRTATKTTKIVVKERPNKWFEEGKMSALSHDTGAYAQFYDENFS
YDLWAERAKKAGMTLLSTEALQAVYYWPGPGATNANLQHPYTLEEVDGKLQPKDMVKLAK
EAAERHGLRFGVYYASEGSNRLPNGHTNNSSGFFANVEDLMKRYDPSYLFFDGGPQGKGN
VDAMWSAVRAYNDYALIQANDQNEAGDNDLTILETEYTGKMPYVHGGYWETNMLNQNKYT
VEEAWTHPFFQEIGVWAQYAGGNMRDDWRLFAEYIIYSIGHGIVPNYDQMIVNTRGVNWS
GIGFAAGSKDEYYYLPLNAQQMIDMRDKVNAWMANEGKPDLHESLFGTMPYYFDTYEKKA
GWHENTEKEPFLTAKYGEGPDWGYTVARNQYIYMHMQENTMGAGRAKVGFTGQESMEVGP
FTDKVLHVEWLNEGRELGFTTSTRDGKNYITIDTSAVKADPVDTIIKITTDSDKRDFTLT
SVKLFGEQTKTTELQLRAEAYLKTYTNVFAPAQLTYTSSNTNVAKVDANGLVTPVGAGKA
TIQVVAEYEGVQASDTYAVKVDAAGNISVDEELIGVVMRTAGKETFGKFSTNKNLPITFE
ARTEKGGGVNVLSYDDVTYHYAVCYGQKDGHVAEADGYWKDHEVDNLNGLLKIIEDEVVF
NGVIPEEENVAIWADITIDGKTYTTNKNFLRLVRSGVLNENIVPEVSSNEADAAAVTDGI
LNSADGGNTSRWTPDQRDQNPTMTFELEKEYTVDGVRVFYNNKDRKYLNTPKEIQIEISS
DNKEWTTVVEAGGVPSASTIYCYEDEKYTYDVNAKAKYVRVTFPEGAADSVMDILEVQIL
GVDLAAVLSEIEVTKTPGADGKELALEVTGYTGQGEVLDLTDGTVTITSDNQAVATVNGN
TVKAAGQGTAKITVQASLSGFEASQVFYVKVGEDGGLVLTDYLKSIAVSLDSTILDNGAH
NKIKADISGKWNTGEAVDLSGAKITCECSSEKLTYNAADGTITVKGTIDTNEMATVRFTV
TVDGVALESQNFDLALVASTFNVPGRIEAEDGIIEGERVRGESGDGGTALGYIMEGDVYT
YFVNVEEAGVYEVYYRAVAEQMDKRIRFYVNGELQGNMRFTEAGDWTTFTTQKQEDLVQL
KNGLNIITLKPQGGGYICNLNWLEFVKVADIEEPVEDPANKYLLQRTYDYAVTLNTDGVA
ESAKAYFEKTLAEAKAVLENEKATQDQVNAAWDNLLDGIWSLGIYKGEKGALKELIDQAK
AMNKDDYEVENWGMLEEALAKAEAVYADEDATQDIVDAAKEELQKAIDAQVLKPVVDKSI
LKQLIDKATAMLPDEERYMADNWPKLTAALEKGQSVYENEEATQEAVNAAADELLGAIMA
QRFKANKSNLEKLVKEAEGVDTARYTAETVKVFQAALTKAKAVLADETLSESEHKSVDDA
AKVLAEAKAALQEKDNTGDGTKDDGKDSPKTGDTAPMALWGMIAMLAVALITGFEKKKWN
RNLR

Enzyme Prediction     

No EC number prediction in MGYG000000574_00004.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	1368	1488	8.7e-18	0.8467741935483871
CBM6	1719	1827	3.8e-16	0.7898550724637681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04080	CBM6_cellulase-like	3.87e-15	1703	1826	1	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
cd04086	CBM35_mannanase-like	6.16e-10	1706	1810	2	105	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
pfam00754	F5_F8_type_C	2.33e-09	1379	1487	13	116	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd04079	CBM6_agarase-like	1.48e-08	1706	1827	5	134	Carbohydrate Binding Module 6 (CBM6); appended mainly to glycoside hydrolase (GH) family 16 alpha- and beta agarases. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family 16 agarases. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the activity of alpha- and beta-agarase catalytic modules which are involved in the hydrolysis of 1,4-beta-D-galactosidic linkages. These CBM6s bind specifically to the non-reducing end of agarose chains, recognizing only the first repeat of the disaccharide, and directing the appended catalytic modules to areas of the plant cell wall attacked by beta-agarases. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. This family includes three tandem CBM6s from the Saccharophagus degradans agarase Aga86E, and three tandem CBM6s from Vibrio sp. strain PO-303 AgaA; in both these proteins these are appended to a GH16 domain. Vibrio AgaA also contains a Big-2-like protein-protein interaction domain. This family also includes two tandem CBM6s from an endo-type beta-agarase from a deep-sea Microbulbifer-like isolate, which are appended to a GH16 domain, and two of three CBM6s of Alteromonas agarilytica AgaA alpha-agarase, which are appended to a GH96 domain.
smart00606	CBD_IV	5.29e-07	1701	1825	2	129	Cellulose Binding Domain Type IV.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIG39446.1	3.30e-274	31	1499	38	1473
QUH29696.1	2.40e-230	413	1499	59	1112
QUH29694.1	1.31e-199	415	1697	60	1264
QUH29695.1	5.24e-199	413	1536	58	1079
AYE35145.1	1.16e-34	1825	2162	995	1341

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26831	1.08e-08	1406	2038	854	1565	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
E8MGH9	8.29e-07	1830	2061	1657	1895	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000258	0.999028	0.000229	0.000184	0.000160	0.000136

TMHMM  Annotations     

start	end
2137	2154