CAZyme Information: MGYG000000574_01030

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000000574_01030
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752		85109.31	5.2405

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000574	5306470	MAG	Madagascar	Africa

• Gene Location: Start: 6596; End: 8854 Strand: -

Full Sequence      

MKNLPEFIAATEEYATHEHSVAAPLFRGVFRIEEKGKVKVSICGLGFYRLFLNGTEITRG
RLASYPSNPDRIYYCDTYGVTDQIQMGDNVLGILLGNGMLNCIGGEMWDFDKVSYRSAPK
TSFQVCVEDRVIFSSEHRVKVHPSPILYDDLREGETYDARQEIPGWCEAGYDDSTWADAI
LAVRPKGICAVNQAPPILVAKEHDCVRLSRAKEGYVYEFPVNTAGICRLRIKGERGQKIT
MQYVEALDASGNPFMGNLVFGCTRRSQQNVYICKGGDEVYEPSFTYHGFRYVYITGMTEE
QARPEALVMLELHGDITEKAKLETSDEIVNRLCAMIGNSDLSNLLHFPTDCPQREKNGWA
GDLAGSANQMALRYDVYGILREWLRNYRVAQREDGALPGYVPTGDCGYEVWTGPSWSMAL
YLTVYYLYRYHGGKEIIEENAEAMERYLAYVMEQKNEDGLIAFGLGDWCQTTVDYADRHT
TPNEITDTLAAVCMTELVDFLLRQTGWNSSVDYKKMNRELRDCFRRKWIAKDGYSCGCDS
QTAQAMCLYYHIFSSEKEEAAFRELVDRIERANRLMDVGILGGYVLFDVLSAHGRSDLAY
QLIVQERAPSYGYFARRGETTLRESLMGHGASKDATILQNGMTIASLNHHFWGFVYTWFV
ERLAGVTINGDCSNVNSAQIEYPSVLLDKVEFEYAFPCGKLRVQWTHTGAGSQLSLHVPK
GAAVSLRAGEMEERLTDGVYIRNVEKERMNER

Enzyme Prediction     

No EC number prediction in MGYG000000574_01030.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	211	726	1.9e-109	0.9861111111111112
CBM67	15	179	3.7e-23	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.16e-64	318	663	2	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.35e-32	42	201	10	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	8.27e-20	215	300	8	90	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA23306.1	1.69e-109	11	740	146	874
QGQ94103.1	5.49e-109	18	666	138	777
AVM44981.1	9.13e-104	23	730	50	753
QMW03094.1	1.46e-103	23	740	157	872
ADF51877.1	1.10e-102	23	740	105	820

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	8.14e-82	23	734	176	904	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	6.61e-68	22	719	301	985	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.35e-58	11	667	123	779	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	5.76e-70	22	746	183	926	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	3.28e-67	22	719	301	985	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	4.75e-63	18	719	164	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	9.63e-51	27	726	178	876	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000574_01030.