CAZyme Information: MGYG000000575_00124

Basic Information

• Species: UBA11452 sp003526375
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452; UBA11452 sp003526375
• CAZyme ID: MGYG000000575_00124
• CAZy Family: CE15
• CAZyme Description: Carbohydrate esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408	MGYG000000575_3|CGC1	46422.75	6.8502

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000575	4988607	MAG	Madagascar	Africa

• Gene Location: Start: 2318; End: 3544 Strand: -

Full Sequence      

MPRSREEIMKDINYDESRIPACTLPSPLDRKDGGRIATAYEWVNRRRPEVLALYQKEVYG
QIPPRPDRMWFETLSVREDALDGAAIRKEIRLHFAMDNGKSHSFVMLLYIPKNAKVPSPV
FLGLNFKGNHAATDEKDVMMTGKDLSGGIVHPDGHASQVHRWQFRETIRRGYASATVCYH
DIFPDRNDEASWHHSIYGLFYPDKTPEEIHARYSAIGAWAWGLSRMLDCLEREPMIDSAK
AMVHGHSRLGKTALWTGATDPRFRLVMSNDSGCGGAALFKRCIGENVEAILSSFPYWFVT
PFANYIRNEAGMPFDQHWLISLIAPRPVCIASATEDLWADPKGEFLSGVHAAEVYRLFGA
EGLGTDVMPPPDRSVTGEISYHLRTGKHDQTLEDWLHYWELADRLFRK

Enzyme Prediction     

No EC number prediction in MGYG000000575_00124.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	23	407	1.5e-83	0.9925650557620818

CDD Domains     

MGYG000000575_00124 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASV74750.1	1.46e-131	12	406	60	458
QGQ23436.1	9.27e-123	13	407	26	423
QEG14499.1	1.31e-122	13	407	26	423
QGQ32078.1	1.31e-122	13	407	26	423
QDU00661.1	2.63e-122	13	407	26	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SYR_A	6.16e-106	4	403	16	423	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6EHN_A	8.54e-105	13	403	3	396	Structuralinsight into a promiscuous CE15 esterase from the marine bacterial metagenome [unidentified prokaryotic organism]
6GRW_A	1.94e-104	21	403	4	394	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	3.40e-104	21	403	22	412	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYV_A	9.61e-104	21	403	22	412	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	9.24e-104	10	403	28	424	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
P0CU53	6.49e-22	24	359	45	338	4-O-methyl-glucuronoyl methylesterase 1 OS=Wolfiporia cocos (strain MD-104) OX=742152 GN=WOLCODRAFT_23632 PE=1 SV=1
P0CT87	1.44e-21	24	363	111	404	4-O-methyl-glucuronoyl methylesterase 1 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.18.61.1 PE=1 SV=1
D8QLP9	4.05e-20	24	359	36	324	4-O-methyl-glucuronoyl methylesterase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_238770 PE=1 SV=1
A0A0A7EQR3	1.74e-19	13	359	106	405	4-O-methyl-glucuronoyl methylesterase OS=Cerrena unicolor OX=90312 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000575_00124.