CAZyme Information: MGYG000000575_00923

Basic Information

• Species: UBA11452 sp003526375
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452; UBA11452 sp003526375
• CAZyme ID: MGYG000000575_00923
• CAZy Family: CE1
• CAZyme Description: Diacylglycerol acyltransferase/mycolyltransferase Ag85A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
262		29543.95	7.3237

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000575	4988607	MAG	Madagascar	Africa

• Gene Location: Start: 9705; End: 10493 Strand: +

Full Sequence      

MAFFECSLFSESLGMVSSVNVVLPQKTSGQIGLKGVAGEGGCPVLYLLHGMSDDHSIWLR
RTSVERYATQYGLALVMPNAHRSYYTDMACGLKYWTYISEELPRLMHSFFKLSEKREDTF
VAGLSMGGFGAFKLAFNCPQKFAAAASLSGALSPLQLLSRIPERAAEFRNIFGDAMAVAG
SINDLYAQSELCAKNGVVLPKLFMTCGTSDFLYEENQKFRRHLENLKIEFTYDEGPGTHE
WGYWDQKIQQIIRWLPIRRERI

Enzyme Prediction     

No EC number prediction in MGYG000000575_00923.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	10	255	1e-53	0.9779735682819384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	6.28e-41	10	258	19	311	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	6.96e-17	10	255	1	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
PLN02442	PLN02442	6.43e-09	9	237	24	258	S-formylglutathione hydrolase
COG2382	Fes	1.27e-05	43	244	99	284	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PRK10439	PRK10439	6.55e-04	79	142	252	313	enterobactin/ferric enterobactin esterase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLY33105.1	2.55e-13	37	249	69	313
BBZ28701.1	4.54e-13	39	252	56	307
BBY18979.1	7.24e-13	37	251	71	321
SNW20539.1	1.29e-12	21	251	54	324
BBZ63842.1	1.34e-12	37	251	69	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	1.83e-106	1	258	2	264	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
7L0A_A	4.01e-51	1	255	9	258	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
6VH9_A	1.90e-50	2	255	4	252	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]
4ROT_A	7.69e-50	1	261	8	263	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
2UZ0_A	2.33e-47	43	257	42	254	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	1.80e-36	1	255	1	261	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
Q8X5J5	6.77e-10	9	235	20	251	S-formylglutathione hydrolase FrmB OS=Escherichia coli O157:H7 OX=83334 GN=frmB PE=3 SV=1
B1LIP0	5.71e-09	9	235	20	251	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain SMS-3-5 / SECEC) OX=439855 GN=frmB PE=3 SV=1
Q8FKG2	1.05e-08	9	235	20	251	S-formylglutathione hydrolase FrmB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=frmB PE=3 SV=1
Q0TKS8	1.42e-08	9	157	20	177	S-formylglutathione hydrolase FrmB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=frmB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000575_00923.