CAZyme Information: MGYG000000575_00966

Basic Information

• Species: UBA11452 sp003526375
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452; UBA11452 sp003526375
• CAZyme ID: MGYG000000575_00966
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431		50694.44	6.3913

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000575	4988607	MAG	Madagascar	Africa

• Gene Location: Start: 28995; End: 30290 Strand: +

Full Sequence      

MYDVFSLPDFNFPEGFLWGSGTAGHQVEGDNIHSDAWHQEQKDQRDEPSGKACDNWRLFR
EDALLVASLGHQAYRYSIEWSRVEPEEGRFDQPALDHYKEMSELFRQLGIKTFVTLNHFT
VPQWFAAKGGFWKRENLPYFLRYAERVVKTLGGLVDFYLVINESTHTRIDTQLGFNHLVA
HARTYRLIKSLCNVPVSSAHMATQTFPYRYYDELDRVMAAYRDFQYNGCFLHAIATGELI
SPFGEAEECPELKGAADYWAVNLYTRELIDSRRKELSASRFPHKKLRMIDKDFYLEEMYP
EGMTAMLERFRDKPVYITENGCSCNDDRFRIVYLALYLSAVHDAVRRGMDVRGYLYWSLM
DNYEWSSFLPRFGLVDVDFKTFERTPKPSAAFYREIIENNGFSQQILRKYLHELPMLEAI
RFRPEVFSKRC

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	11	401	2.9e-102	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	3.81e-88	11	401	3	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	1.95e-74	12	402	5	453	Glycosyl hydrolase family 1.
PRK13511	PRK13511	2.77e-51	10	399	3	465	6-phospho-beta-galactosidase; Provisional
PLN02814	PLN02814	9.65e-39	11	393	27	476	beta-glucosidase
PLN02998	PLN02998	2.20e-38	11	398	30	486	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43515.1	7.16e-310	1	421	1	421
ADW18818.1	7.80e-171	1	418	1	433
ADQ08048.1	6.17e-118	1	417	1	426
QCX34294.1	2.82e-112	1	415	1	422
QNM13665.1	2.18e-109	1	418	1	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VFF_A	4.34e-78	12	410	5	416	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
6Z1H_A	7.32e-67	12	401	11	449	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
6IER_A	1.38e-62	9	391	29	422	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
4R27_A	1.40e-57	12	390	7	402	Crystalstructure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167],4R27_B Crystal structure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167]
5OGZ_A	2.04e-52	7	402	1	448	ChainA, Beta-glucosidase A [Acetivibrio thermocellus ATCC 27405],5OGZ_B Chain B, Beta-glucosidase A [Acetivibrio thermocellus ATCC 27405]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26208	9.43e-52	7	402	1	448	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
P22073	2.85e-47	10	400	4	442	Beta-glucosidase A OS=Paenibacillus polymyxa OX=1406 GN=bglA PE=1 SV=1
Q08638	3.81e-47	12	401	6	443	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
P10482	4.62e-46	9	401	2	455	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
B9K7M5	5.18e-46	12	403	4	443	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999308	0.000596	0.000063	0.000004	0.000003	0.000038

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000575_00966.