CAZyme Information: MGYG000000575_00973

Basic Information

• Species: UBA11452 sp003526375
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452; UBA11452 sp003526375
• CAZyme ID: MGYG000000575_00973
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
506		57495.07	8.7914

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000575	4988607	MAG	Madagascar	Africa

• Gene Location: Start: 116; End: 1636 Strand: +

Full Sequence      

MAKSQKKRHLLLLFILVSVRKLIEILQRWADRLEHYIESAGKDTEEITGKIELNNTVKML
TGLTILAVIASLTLTGWIESFVSGLQTLDLYVLIFSFILLAGNLFYFAWQIILAFHYRPF
DEVTDDQLPHCAVIVPAYNEGKQVVLTLDSLLKSDYPPSKMEIIAVNDGSCDDTWDWISK
SVKSSNGRIRAVNLRQNAGKRNALYQGFLSSEAEIVVTIDSDSIVLPDTVRKIVAPFIGH
PKTGGVAGNIRVLNFSDGIIPRMLDVNFVFSFEFLRSAQSMIHSVFCTPGALSAYRRGVI
MPFMEEWVNQKFMGRPANIGEDRAISNIILREGYHVVFQKSAFVYTEVPKCYGGLCKMFI
RWSRSNVRENLEMFKFAFRRIDFTDEDLLGMQINLIMQTLWTLTPMLFVASTIYCLVVSP
LTFLYASIMATLIWSTLPAFVYASKYSKKDALWSYVYGVFNFLSLSWIGPYSILTIHRSG
WLTRSKPKKDTESVIELAKENTVITK

Enzyme Prediction     

No EC number prediction in MGYG000000575_00973.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	133	300	3.7e-29	0.9647058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	1.37e-44	133	322	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06434	GT2_HAS	2.36e-43	131	369	2	235	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
COG1215	BcsA	2.41e-40	88	483	15	407	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	7.13e-38	90	441	16	352	N-glycosyltransferase; Provisional
cd06439	CESA_like_1	3.24e-34	105	350	5	232	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACN17701.1	3.24e-138	108	505	62	457
ACN15324.1	7.43e-134	108	484	69	443
BCS52180.1	1.32e-132	109	484	66	439
QBH12450.1	2.46e-130	47	493	2	449
QRI49791.1	1.03e-128	99	491	86	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	9.29e-11	118	350	30	250	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	9.35e-11	118	350	31	251	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P50357	1.74e-31	129	487	49	398	N-acetylglucosaminyltransferase OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=nodC PE=3 SV=2
Q07755	1.84e-31	129	484	48	394	N-acetylglucosaminyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571) OX=438753 GN=nodC PE=3 SV=2
P17862	7.19e-31	121	503	41	414	N-acetylglucosaminyltransferase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=nodC PE=3 SV=2
P0DB61	2.33e-30	63	371	8	307	Hyaluronan synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=hasA PE=3 SV=1
P0DB60	2.33e-30	63	371	8	307	Hyaluronan synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=hasA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.958856	0.039916	0.000770	0.000035	0.000020	0.000399

TMHMM  Annotations     

start	end
59	81
91	113
399	418
422	444
451	473