CAZyme Information: MGYG000000575_01495

Basic Information

• Species: UBA11452 sp003526375
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452; UBA11452 sp003526375
• CAZyme ID: MGYG000000575_01495
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		40570.51	5.9141

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000575	4988607	MAG	Madagascar	Africa

• Gene Location: Start: 14640; End: 15725 Strand: -

Full Sequence      

MKNIPDALHGTIIASNPNDPFGYYAWPTVARTEEGTLWVAASGMRNSHICPWGKSVIFKS
CDNGCTWTGPIVVNNSMIDDRDCGLLALPGNRLLLTWFTADTRRIAFVSENIQHILDYRP
ILGGWTNETVKLELGSFTREMEKDGSWGEKRAVPVSTPHGPILLRSGGWFYFGRNAQGAC
QGNKGDDTDGLDVFTSSDEGKNWEKIFHLPQPHDNSFYCEPHVLELPGGKLIGMIRQEGG
SHPFSILQTESTDQGKSWSLPHFIAKGSPPHLMRHSNGTLICTYGWRDFPGYGQRVMFSK
DEGKTWDTNWILRDDAPSDDLGYPSTVELADKSLFTVYYQHPDIQNANSTLMWSRWRLPE
E

Enzyme Prediction     

No EC number prediction in MGYG000000575_01495.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	34	338	6.5e-16	0.6842105263157895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	3.76e-19	11	338	1	322	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	3.09e-14	64	335	29	279	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam15902	Sortilin-Vps10	1.36e-05	192	316	2	116	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.
cd15482	Sialidase_non-viral	1.13e-04	221	360	17	190	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43453.1	4.30e-109	20	359	19	361
QKJ33212.1	1.22e-68	19	358	92	423
AHF92757.1	8.94e-63	20	358	35	377
AWI09304.1	9.05e-60	8	361	28	381
BCS39459.1	3.17e-59	10	343	16	336

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000575_01495.