CAZyme Information: MGYG000000575_01691

Basic Information

• Species: UBA11452 sp003526375
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452; UBA11452 sp003526375
• CAZyme ID: MGYG000000575_01691
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
568		63639.86	6.9491

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000575	4988607	MAG	Madagascar	Africa

• Gene Location: Start: 8027; End: 9733 Strand: -

Full Sequence      

MFNRLNQSQKQWVEQTLSGMTTDEKIGQLDCEFAPRIMSDHSDYGTYLKQYPPGIIWIGH
YGKPPAPGMKKSEVAQGITGPFENKIRIPPIFCGDYESGLGEEIAGFTKVPRMMNLGAAF
DPAACYEFGRIMSEEARIAGINLICGTVSDLNLNPYNPVTNVRSIGDNAEYASRFLVELT
KGIQDNGVAACSKHFPGDGVDFRNQHYVTSLNTLSRKEWFAGHGRVFKALIDAGVMTMMV
GHLGLPFFDQPDPQDGRYRPASLNKHILQDLLRGELGFKGLIMTDSMNMAGYSSWFNTQE
ERILESFNAGVDFFLFPGAEVFFRTMKRALADGRVTMERIEESVRRILSVKALLNLHLAK
QKPDDSEPLADMLEHNRNSAERIAAKSITLLRNRKGLIPLKLDKGARILLLSTPDVPAGH
GSMIPFWEELKKRGYEVNYLPFKFFHTVSMVPDAYDMTILICCAQSRYGDPRGFDSTIWA
FMAAPLKKRLIISFGTPYYLYDVDSADTYINAYSNSPVVQTATAKAIFGEIPFQGHSPVS
MPYCFKFGDGITCENEKEESHVFQTSKK

Enzyme Prediction     

No EC number prediction in MGYG000000575_01691.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	85	315	1.2e-49	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	3.13e-68	20	413	1	362	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.13e-57	21	350	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	5.02e-20	106	312	74	275	beta-hexosaminidase; Provisional
PRK15098	PRK15098	5.00e-16	5	411	29	416	beta-glucosidase BglX.
PLN03080	PLN03080	8.08e-06	260	401	273	416	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ15499.1	7.66e-108	1	539	1	556
CQR51622.1	4.25e-107	1	539	1	556
AIQ55772.1	7.98e-107	5	539	5	556
QQZ62871.1	1.67e-106	5	539	5	556
AIQ66488.1	4.68e-106	1	539	1	556

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	2.85e-68	5	539	13	556	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
6K5J_A	3.09e-48	20	541	11	531	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	7.83e-48	15	551	37	627	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.73e-47	15	551	11	601	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.08e-47	15	551	41	631	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	2.82e-73	12	539	18	553	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	4.29e-47	15	551	37	627	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	3.00e-25	83	415	93	438	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
B8NGU6	7.87e-22	13	401	53	462	Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglC PE=3 SV=1
A9M1Z4	1.72e-21	86	315	59	287	Beta-hexosaminidase OS=Neisseria meningitidis serogroup C (strain 053442) OX=374833 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000575_01691.