CAZyme Information: MGYG000000575_02182

Basic Information

• Species: UBA11452 sp003526375
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452; UBA11452 sp003526375
• CAZyme ID: MGYG000000575_02182
• CAZy Family: GH163
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
963		110185.28	9.3442

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000575	4988607	MAG	Madagascar	Africa

• Gene Location: Start: 15732; End: 18623 Strand: +

Full Sequence      

MKKLLSLLLAAELGTAFAAGELFSNGKSDWQIVIPEHAGTTVQYASEELQRALKKVSGTE
LPIIKNKSPGISNRIVIGDLSSNLIKEKASALKLAFSPIEEIAVHTLDGNLYLAGNTPRA
ALYAVYTFLQDQLDIRWLRPGPEGEYMPQLKSYTLPELSVNKKPSFRYRGLHLCYRHVDP
EFETWMARNFINIMRSDAGQRKTHQQRKMKGYHIMISNHNAHLPASLFKTDPECFAELNG
KRHNRQICMTNPKTEKLVAEQMKKWVRNNPELEILSVFPADNMDYCMCKGCTAQDRSTTW
FNFFRKICLDVREEFPKLKFSTIAYQGYLKAPKTDLSFAEIIEYCNHNRCYTHQLDSACP
LNQRDLKDFTEWSTLKVPMGIYGYEFDIFAAENTVSIPFYNVIREGIRKFHSLGVQSVIT
EYWLGFPAKNPQERRLSVQNALGVWLYTRLLWNVNDDMDKLIAEWNSKMYGGAAREAAEI
TRILSENWDQLKGHISNYHNAPFGTAAAMFTPERFTKLKKLLKNGFEKKLSPQERTNFEL
LQSFVLQWEQVYFEGTQSNRQINIPKTPNAPYALPAFQTNNQGKAPRTDAFFSWDDKYLN
ITVHCYDSDMKKLRAEALKRDEQVWMDDCIEIFLSNPANTEGIYKHIAVNPRGTLYDAAA
YGPGGADIHWNPEIKVKTELLPDHWKVDLKIPFASNPPVPKAGDVWRFNINRSIGNGRKR
MANSGYPEASYHNPNGFAALSFSEKARVEKQVLFLVPEKFMKNTKNIGNALFRDGWNFQF
CSCQKELPQNLDSYRILVVRLPQFGLQGKVDFKKLAREFLNQGKTVIFSSYEWLPLENYL
GDPKLKLQGSGWKINKLRRNLDISTGKWGTTPENLQQPIKELLSPSYGYNPQTPEGWKSL
ISLEREDGKKFSTMLVRKQFNGLLIVTGGEMGLGGGHVLFGNTVNTVTMLLNNLLANRKE
LME

Enzyme Prediction     

No EC number prediction in MGYG000000575_02182.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH163	225	476	2.4e-42	0.9601593625498008
CBM9	583	739	5.9e-18	0.8406593406593407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16126	DUF4838	1.63e-29	228	474	15	256	Domain of unknown function (DUF4838). This family consists of several uncharacterized proteins found in various Bacteroides and Chloroflexus species. The function of this family is unknown.
cd09620	CBM9_like_3	1.52e-21	570	712	14	170	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
cd09618	CBM9_like_2	5.56e-19	561	714	1	171	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.
cd00241	DOMON_like	7.25e-10	588	720	20	152	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd09621	CBM9_like_5	2.37e-06	590	742	32	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEC56321.1	7.37e-111	22	958	31	996
QEC56322.1	5.51e-106	40	952	48	991
QEC43636.1	3.46e-89	44	952	49	983
QEC43641.1	7.85e-73	32	960	38	802
AIF26900.1	1.13e-41	22	500	6	493

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000268	0.999031	0.000186	0.000183	0.000173	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000575_02182.