CAZyme Information: MGYG000000575_02397

Basic Information

• Species: UBA11452 sp003526375
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452; UBA11452 sp003526375
• CAZyme ID: MGYG000000575_02397
• CAZy Family: GH129
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
613		68882.71	6.4516

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000575	4988607	MAG	Madagascar	Africa

• Gene Location: Start: 9258; End: 11099 Strand: -

Full Sequence      

MYTEISNSCSCFLKAILFDLAEQREVSATEFRLVRSFRTENRTKFFFRADQFGLVIPLIV
EKRSGSRCLVKIGAGTVVEQNSIRYRLMRLAVLPELLETAVGDDGAYLLSVGAGVLADFR
ERPYTVNADRIYMEQREWEKMSMMNCFGRIHAAGNVLAVVESGDFHCRVVSEYNDRGRNR
IFAEFEMRSGPSEMLKYEDKTLLFISCPAGSGYSGLAFAYREYLLEHGMDTLKTRMEGNP
VLQYSAEAVRVKIFMAVKEPYVPDGSSPVKVLTNCDEACIILDGMKAGGIEKAVVTLVGW
NLGGHDGAYPAHFPVEPAIGGEKGLRKLIAYAGKLGYQIVPHDNVTDIYRGSPDFDYEYV
ARNEGGEPLAAGVWGGGQSYKACPRVFLERYGYEFERIRNLGFAGHYYMDAQSTVMWRCH
AGRHPADEREFALALSAITTVPRMLYGAVSAEGAAAYILPFIDEVSRLHTPLTAPEMLKK
SPPALRSLNPRPVPFYHIALHGLLLYQDHWVHGYRDVKRGQLYELVLGARPSMEISYRTD
GGNGGDYRKCIEMLKESCRWCYQELKVQCELVTSFSEPEDGFYEIVYANGTGIRVNLTDH
EVNGVPSESWLRF

Enzyme Prediction     

No EC number prediction in MGYG000000575_02397.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH129	210	601	1.6e-21	0.6197411003236246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18952	DUF5696	1.45e-46	40	603	10	597	Family of unknown function (DUF5696). This is a family of unknown function with some overlap with clan family members of CL0058.
cd14244	GH_101_like	5.12e-15	281	380	30	135	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.
pfam12905	Glyco_hydro_101	0.007	295	366	61	133	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43182.1	2.86e-124	13	583	32	595
ALS27998.1	2.60e-12	213	602	363	750
QYR21414.1	9.71e-11	47	610	189	789
QNK60245.1	6.48e-10	103	601	220	740
QNI37238.1	5.82e-09	263	380	330	445

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000575_02397.