CAZyme Information: MGYG000000575_02473

Basic Information

• Species: UBA11452 sp003526375
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452; UBA11452 sp003526375
• CAZyme ID: MGYG000000575_02473
• CAZy Family: GH13
• CAZyme Description: Alpha-1,4-glucan:maltose-1-phosphate maltosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1431		160400.4	5.9425

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000575	4988607	MAG	Madagascar	Africa

• Gene Location: Start: 198; End: 4493 Strand: -

Full Sequence      

MAKYIQTPVQGKHCLLYCGDLLEFRIESDTVIPGAVYLMTNLGNAAWKRSETIARVEKGV
TPGFQDWHNVRMNKVDDYTYSLTLMLTEEGHFEAKCYIAGENGEEPVWIEGENVHVNVEP
ATYCCSNSIYCAFVRQFGMNKYNAVSRLPENVSREELARLDGDAYSVIPPSGTFRDLIKE
LDHIFDTLNCRILHLLPINPTPTVYGRMGRYGSPYAALDFTAVNPELAEFDRKATPLDQF
RELVDAVHRKNGKVFIDIAINHTGWAAKIHETHPEWLVREPDGTIHSPGAWGVVWGDLTE
LDHSKPELWKYLATVFRTWCMRGVDGFRCDAGYMIPEAAWEYITSCVRDEFPETIFLLEG
LGGDPAVTANLLDKANMNWAYSELFQNYSREQIEGYLKYAWLRSAGDGIMVHYAETHDNS
RLAAVSPEYARMRTALCALTSTNGAFGFANGVEWFATEKIDVHESSALNWGAVPNQVDLI
SRLNTILAAHPAFHNGAVVNFIDSGTPSGVIVGRSDPDGDSSVIVAINLETGKSTNVSWN
IYSAPFDAETVYDLISGRRISLVRASGGRRSLMLSGGQMFCLCKDRKELERVIELEARDR
FLPEKIERQEAAAMAFRAIAAKNNSIISCGEDSVSAAESILRSPEQFLRDLYGDGLEAPF
TYWQWPADAKRAVMLPPGHFLLVKAPCRFRACFVIDDKVVSLANSLHESSGIFFALLPPV
PVPEKHKEAKLIISVFGSEKLERRISPVMILAEDVKEFKLSYGRDELRRDKRNFLQANGR
GGLIWMPVEPNELRSRYDAVLLGNLNPDYPVNRHIMLRRFRMWAVHHARIQEFTIDCLKE
FHIADNGGGVWEYELPVGNGMFVEIRVKQEILYDENAVMLTLVRSSCEGKGHRLCDNTPV
KIIVRPDVEDRSFHEETKASMGPERYWPGLIKASDHGFEFHAASDRILSVTGSRGRFRRA
EEWTYMIWQEKEASRGLEPNSDLFSPGYFTVSLAGGEALYIAGQMLTSPDAPKIPPAMVS
EAAFAKRRDTSVEDTMLTALSQFVVKRGDLKTVIAGYPWFLDWGRDTLIAVRGLIAAPEF
RDHVKAILLQFASYADRGTIPNMIFGGNADNRDTSDAQLWLFTACSDLCRAEGGFSFLEQ
QVRNGKTLLETLISLAEGLIAGTPNGIAVDPESMLVFSPSHFTWMDTNYPAGTPRQGYPI
EIQALWFAALRFLAEAVGGAAGEEWRKRSVQVAASISKYYVLKGRDYLSDCLHCNPGVPA
SKAVPDDHLRPNQLYALTLGAFRDHRRSMLILDACSKLLIPGAIRSLADQKTDYALAIYS
SSGVLLNDPVHPYWGRYEGDEDTRRKPAYHNGTAWTWQFPAYCEAYYMIYGKAGCRTARS
LLSSCSLIMNDGCISQLAEILDGDYPHIQRGCGAQAWGISEYYRVWKLLHE

Enzyme Prediction     

No EC number prediction in MGYG000000575_02473.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH133	1049	1423	2.4e-90	0.9731182795698925
GH13	179	376	6.6e-31	0.8952380952380953

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06202	GDE_C	3.38e-73	1042	1424	5	374	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
cd11313	AmyAc_arch_bac_AmyA	2.13e-50	129	496	7	336	Alpha amylase catalytic domain found in archaeal and bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase). AmyA (EC 3.2.1.1) catalyzes the hydrolysis of alpha-(1,4) glycosidic linkages of glycogen, starch, related polysaccharides, and some oligosaccharides. This group includes firmicutes, bacteroidetes, and proteobacteria. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
COG3408	GDB1	4.26e-31	896	1424	124	601	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
cd00551	AmyAc_family	1.26e-27	161	444	12	247	Alpha amylase catalytic domain family. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; and C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost this catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
pfam12439	GDE_N	1.80e-25	772	1000	1	209	Glycogen debranching enzyme N terminal. This domain family is found in bacteria and archaea, and is typically between 218 and 229 amino acids in length. The family is found in association with pfam06202. Glycogen debranching enzyme catalyzes the debranching of amylopectin in glycogen. This is done by transferring three glucose subunits of glycogen from one parallel chain to another. This has the effect of enabling the glucose residues to become more accessible for glycolysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQV01271.1	0.0	5	1429	8	1432
AOY59008.1	0.0	5	1429	8	1432
BBO70997.1	0.0	6	1426	9	1425
CBX27385.1	0.0	6	1431	9	1430
ABC78593.1	0.0	6	1429	7	1420

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1WZA_A	3.14e-11	172	341	24	209	Crystalstructure of alpha-amylase from H.orenii [Halothermothrix orenii]
1CYG_A	3.90e-10	215	557	96	458	CyclodextrinGlucanotransferase (E.C.2.4.1.19) (Cgtase) [Geobacillus stearothermophilus]
6L2H_A	6.79e-10	215	568	100	476	CGTasemutant-Y167H [Paenibacillus macerans]
4JCL_A	3.49e-09	215	568	100	476	Crystalstructure of Alpha-CGT from Paenibacillus macerans at 1.7 Angstrom resolution [Paenibacillus macerans]
6AIJ_A	3.55e-09	215	568	121	497	Cyclodextringlycosyltransferase from Paenibacillus macerans mutant N603D [Paenibacillus macerans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D651	1.39e-18	172	559	221	628	Alpha-1,4-glucan:maltose-1-phosphate maltosyltransferase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=glgE PE=3 SV=1
B3DYJ8	8.40e-14	164	539	218	609	Alpha-1,4-glucan:maltose-1-phosphate maltosyltransferase OS=Methylacidiphilum infernorum (isolate V4) OX=481448 GN=glgE PE=3 SV=1
P20845	4.28e-10	172	369	59	282	Alpha-amylase OS=Priestia megaterium OX=1404 PE=1 SV=1
P14899	1.23e-09	172	331	54	214	Alpha-amylase 3 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) OX=309799 GN=amyC PE=3 SV=2
P31797	2.20e-09	215	557	127	489	Cyclomaltodextrin glucanotransferase OS=Geobacillus stearothermophilus OX=1422 GN=cgt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000575_02473.