CAZyme Information: MGYG000000575_02552

Basic Information

• Species: UBA11452 sp003526375
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452; UBA11452 sp003526375
• CAZyme ID: MGYG000000575_02552
• CAZy Family: GH63
• CAZyme Description: Periplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534		61136.5	5.7831

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000575	4988607	MAG	Madagascar	Africa

• Gene Location: Start: 9051; End: 10655 Strand: -

Full Sequence      

MNRYPTVWGGGQLLAFSGIDGVTDYENGLRLRTAFEGYVFELKQDGYTPPDPVIRYTGSA
PEKVELTGDFFRFHTAGGVSSGVLVDARHLLLEGDFELELLNRYDSVASGNRKLVAAKGF
LKKELLELDIADEIAKRGKFLLSAPLPEDVSEAARRTTLKALSQLKTQIYSPEGRIRHFW
STPDRWPHKQMWLWDSVFHALGMRHCNPALARDMISAMFDLQQENGFIPLCGNPHGVHRL
TQPPVLALAMKLVNESEPAPEWIAELAPKLERYLEWIMANRDSDGAGLVEWAIEANENCR
SGESGMDNSPRFDCALQLDAPDFNAYLAFECEQLAGFLPERRDYWMGHYKRLCRLMNERL
WSDPVGLYVDYDVVNGCRTEIMSSAGFLPLYCGAATKVQAERMVRHLTDPETFGTPLRVP
SIAKSNTAAYRKDMWRGPVWTNINYLIALGLERYGYHELARGIVCDTLREQEKWYLECGT
FFEFYDDRKEVEPRKLERKGISPDGSYHPFHQVFHDYGWSATLYLEMINRKEWR

Enzyme Prediction     

No EC number prediction in MGYG000000575_02552.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	150	489	8.1e-44	0.4017543859649123

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	1.08e-27	149	464	301	736	alpha-glucosidase; Provisional
pfam01204	Trehalase	2.97e-20	189	530	126	507	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	9.81e-16	193	527	94	492	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG1626	TreA	1.01e-12	172	528	165	549	Neutral trehalase [Carbohydrate transport and metabolism].
COG3408	GDB1	4.84e-08	192	461	285	558	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44395.1	1.29e-182	7	530	9	529
AHF91275.1	4.68e-156	8	528	71	591
QTE69242.1	2.71e-83	7	528	6	545
QCX74290.1	8.01e-44	144	486	309	705
QDQ09626.1	2.68e-43	150	486	311	701

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.89e-22	59	486	200	730	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7W_A	3.35e-22	59	525	200	751	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7X_A	7.87e-22	59	486	200	730	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
4WVA_A	4.30e-20	177	486	17	396	Crystalstructure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]
3D3I_A	7.38e-20	59	486	201	731	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	1.07e-21	59	486	223	753	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	4.77e-21	180	485	86	461	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	2.04e-20	180	485	86	461	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P94250	7.45e-13	215	461	79	325	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
K5BDL0	2.04e-11	181	486	31	422	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000575_02552.