CAZyme Information: MGYG000000575_02939

Basic Information

• Species: UBA11452 sp003526375
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452; UBA11452 sp003526375
• CAZyme ID: MGYG000000575_02939
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
728		81557.32	5.1281

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000575	4988607	MAG	Madagascar	Africa

• Gene Location: Start: 677; End: 2863 Strand: +

Full Sequence      

MEKQHSWQGVWITAEEKGPLLRRSFQYKKSGERVYALVAGLGWHELYVNGKKADDRVLAP
VVTQYEKRVSYIRYDITELLEPGTNALGVMLGNGWYNCRYPQNAWNFECASWIDLPKLLC
NVVADGKVILKTDCSWKTAAGPILFNSLRNGETYDARCEIDGWSMPEFDDSSWKNAVQYA
PPPGILVEEDMEPCKECECFPCINVKTLGDGSRVYDFGRNLTGWARIQVRGSAGSTLVLK
YSECLAADGDIDQGNIDLYIKEGEFQTDRYTLKGAPDGEAWSPRFTYHGFRYLKISGVTA
DVVIEKVEALFVHNAFPSAGLFKCSSELLNRLSKCARQSYLSNFTGIPTDCPHREKNGWT
GDAQIACEAGLWNYNSIRAYKHFIQMLVDAQRPSGQLPGIVPTGGWGYNWGSGPAWDSAL
FEIPFRVLRYYGDDEMIRLHYEAMRRYIDFCTGMSENCLVNFGLGDWCAPNRAPVNTVEL
TSSAYYYYDTWLFSRFATLVGEAENDVYLYSRLAEDIKLSFNTKFYCGDGVYGDGSWTAL
AAPLYFGLAPKGEEQKIADLLASKVAANGYKADFGILGAKYVPRVLADYGYAEHAFRLIT
QEEFPGWGYWIRKGATTLWEDWSGGSSHNHIMFGDVSAWMFEYLAGVKPLKNGFAEFRVA
PNAVGGLTNLIMTHDAPCGKIVVDWTREEKRFILTLTVPKGATAEVILPGGGSSRAGEGV
QFFEVEME

Enzyme Prediction     

No EC number prediction in MGYG000000575_02939.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	206	708	4.9e-156	0.996031746031746
CBM67	14	183	2.2e-31	0.9090909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.29e-106	317	644	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	8.88e-49	33	198	7	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.94e-31	206	313	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	5.02e-18	646	719	1	74	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	0.002	424	565	348	510	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44981.1	5.60e-229	4	724	26	757
AVM44977.1	4.91e-212	11	701	8	696
QGQ94103.1	2.29e-203	7	709	123	841
QNN24933.1	3.15e-193	19	709	353	1055
AHF16194.1	9.85e-189	7	710	137	863

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.35e-150	4	709	142	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	4.85e-103	21	725	305	1021	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.61e-96	12	725	125	865	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	9.28e-107	22	708	188	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	2.13e-102	21	725	305	1021	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.29e-89	7	713	149	883	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.86e-81	7	709	146	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000575_02939.