CAZyme Information: MGYG000000575_02943

Basic Information

• Species: UBA11452 sp003526375
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452; UBA11452 sp003526375
• CAZyme ID: MGYG000000575_02943
• CAZy Family: GH163
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
761		86538.83	9.1151

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000575	4988607	MAG	Madagascar	Africa

• Gene Location: Start: 6436; End: 8721 Strand: -

Full Sequence      

MKYKILPALLLFCTLFSLAALEITRNGAPCARIAVAKDAPYVEQFAAKDLQHWIREISGA
ELPIVNEAGKEGGTTIFIGKTFAERLWQKEIAELNGSDGFAVRSVGSRIYLFGSVPRASA
YAAAALLERNTDIIWARPDEKTGCVFSGNPNLRFTELSFLEKPAFKFHGWNVVAVRRDRP
TGIWVLRNRGNWADQTSPAKAGNEFNFLNCEGGHIYWWMAHPDRYFKTNPEFFGFSKLTG
KREPETLCLTNPELLEVAVGNLKKRIRAFKEKPDLFTIGFRDSWTMCQCEKCLAPIPLSG
GGTLIRKSDNPQEDPLYFSTRYWLFVNQIVERLKQDFPETMFAGSGYFYAAVPPACELDP
AVIVSCCPIGGVNGRYPLLDKRQSPVWKRRLEQWSKRFPGRLLFYEYYRSYASGFAEISG
TSGIEQKIVHDLRDLKRLGGIGVNSELTPDSERKFSNHTMKSEWDANSVSAWILARLIWN
PAENPRALRDYYLERTFREAAPQMKRFYDLLDEGFRKSDGKRPDFIHTVIQTGLEKKCFD
ALCEAEKTARHPNSLSMIRSLKKQWITARGRLGANTVPRMESEEKFMDFHATCYETSLII
DDFRLPGYFNWGKTTPAARRTEARLLTDGTMLYIRLTAENPSPELMEKSAPDLWPSGDHI
ELRFENRGKTFCFAVDGNGNRYDSLNSDRKWESGWKVLTARSNDGWTALLAIPLKALGVE
PGNRNTFPSLLLIRRSHDGTRVQESTPKGIFPGQRQTPLTF

Enzyme Prediction     

No EC number prediction in MGYG000000575_02943.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH163	222	507	5.5e-38	0.9800796812749004

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16126	DUF4838	1.83e-42	212	508	1	263	Domain of unknown function (DUF4838). This family consists of several uncharacterized proteins found in various Bacteroides and Chloroflexus species. The function of this family is unknown.
cd09618	CBM9_like_2	5.51e-13	615	727	40	163	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.
cd00241	DOMON_like	6.01e-04	611	727	10	140	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd09620	CBM9_like_3	6.35e-04	611	724	22	157	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDU96994.1	3.91e-128	19	759	19	767
QEG42594.1	1.83e-114	19	722	19	728
QDV26494.1	2.18e-111	15	722	7	728
QDV12958.1	2.03e-98	46	761	277	999
QDU93450.1	1.13e-90	33	749	276	994

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002101	0.996618	0.000638	0.000197	0.000197	0.000221

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000575_02943.