CAZyme Information: MGYG000000575_03048

Basic Information

• Species: UBA11452 sp003526375
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452; UBA11452 sp003526375
• CAZyme ID: MGYG000000575_03048
• CAZy Family: GH4
• CAZyme Description: Alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
451		49609.25	5.6654

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000575	4988607	MAG	Madagascar	Africa

• Gene Location: Start: 5313; End: 6668 Strand: +

Full Sequence      

MAKIAMIGAGGVIFAQNFIKDILLDGLLRQSEVTLMDIDRERLENAGKMAEIMSAQFGVA
FKPELTTDLRKAVRGADYVITIFRVGTLEHQRLEYEIPARYGVKQVVGDTLGPGGVFRGL
RTLKALFEVLDAMEAECPGAFLLNYVNPMSMNTIALSRRAKTVKVIGLCHSVQGTGMAIA
EWLKVPLEKLHYYAAGVNHQAFMLKLETDGRDLYPELRKCLDCPEIYNRDKVRFELMRHF
GYFPTESSGHGSEYNPYFRKRGDLLEKFCSVTAPADPEDHCCGYLMSAGVPGASLTVCAK
LQAHNEDKLRRLLDGSEKIEPKPSQEYGVQIIRAIEKNAPFSANLNVMNRGLIPTLPPGA
CVEVPCLVNGGGIFPARIEDYPEQLAALNRGMINVQILGAQGALNHSRSDIFHAVAADPL
TAAVLGLDEIQEMTAELFEALASEIDPAFSE

Enzyme Prediction     

No EC number prediction in MGYG000000575_03048.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	3	182	2.5e-58	0.9888268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15076	PRK15076	0.0	1	440	1	422	alpha-galactosidase; Provisional
cd05297	GH4_alpha_glucosidase_galactosidase	9.04e-164	3	438	2	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	7.44e-118	3	440	5	431	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
cd05296	GH4_P_beta_glucosidase	1.57e-66	3	437	2	418	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
pfam02056	Glyco_hydro_4	4.09e-58	3	183	1	181	Family 4 glycosyl hydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44903.1	1.23e-218	1	450	8	457
BAJ62916.1	3.96e-130	1	440	1	434
ADQ40601.1	1.95e-123	1	440	1	427
ADQ46442.1	5.53e-123	1	440	1	427
ACM60205.1	1.11e-122	1	440	1	427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C3M_A	5.86e-46	3	432	6	428	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	3.97e-39	3	432	9	431	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
3FEF_A	8.97e-36	3	420	7	420	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
1U8X_X	2.04e-28	6	415	32	434	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]
6DUX_A	1.31e-25	3	415	6	412	ChainA, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DUX_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_A Chain A, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P30877	2.34e-91	3	440	6	440	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2
P06720	2.34e-91	3	440	6	440	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1
O34645	2.67e-91	1	440	1	423	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
Q9X4Y0	2.58e-61	3	442	5	436	Alpha-galactosidase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=melA PE=3 SV=1
Q9AI65	4.68e-40	3	433	4	440	Alpha-glucosidase OS=Erwinia rhapontici OX=55212 GN=palH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000575_03048.