CAZyme Information: MGYG000000576_01191

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus
• CAZyme ID: MGYG000000576_01191
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276		30716.65	5.0984

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000576	1830013	MAG	Madagascar	Africa

• Gene Location: Start: 313; End: 1143 Strand: +

Full Sequence      

MTLLTVNAMSQSLMRTVTFNVYLPSDKVDMIGNLIAKPPYKTLYLLHGIIGDQNDWLVGT
RIASIAKHHNLAVVMPAGENQFYLDQPDHMNNYSQFIGKELLDLTRNMFPLSHKREDTYI
AGLSMGGFGALHNGLKFHDNFSAIGAFSSGLILEDAVASTDESPVPFQKRSYYKAVFGDL
TTLLESDQNPAYQVRQLAKSSAAIPQLYITCGTEDSLLEANNNFVAELKANKVPHTYETW
SGGHEWAFWDKSVEKFIDWLGLEDDRSGVASDNING

Enzyme Prediction     

No EC number prediction in MGYG000000576_01191.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	10	260	5e-50	0.9779735682819384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	3.09e-29	19	260	37	308	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	2.34e-18	10	249	1	235	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	9.63e-14	10	249	75	284	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PLN02442	PLN02442	6.85e-05	10	148	25	175	S-formylglutathione hydrolase
COG4947	COG4947	7.31e-04	43	257	62	227	Esterase/lipase superfamily enzyme [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY75919.1	7.65e-20	29	256	28	248
QOT12214.1	2.88e-19	29	256	29	249
ACX65534.1	5.54e-19	29	256	29	249
QNE39642.1	9.22e-19	37	256	71	272
AYB44329.1	1.10e-18	29	256	31	251

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	2.74e-45	18	262	19	263	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
6VH9_A	2.19e-35	21	260	23	252	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]
7L0A_A	2.54e-35	21	260	29	258	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
2UZ0_A	1.25e-31	32	263	30	255	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]
4ROT_A	1.06e-30	43	260	49	257	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	2.66e-65	1	260	1	261	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
P10478	7.46e-11	40	272	81	284	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
B1J086	3.53e-06	10	148	21	169	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks) OX=481805 GN=frmB PE=3 SV=1
B1XEU8	3.53e-06	10	148	21	169	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain K12 / DH10B) OX=316385 GN=frmB PE=3 SV=1
P51025	3.53e-06	10	148	21	169	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain K12) OX=83333 GN=frmB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000576_01191.